KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0429Help
Entry
FTV_0429          CDS       T01761                                 

Gene name
hemB
Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00860  Porphyrin and chlorophyll metabolism
ftt01100  Metabolic pathways
ftt01110  Biosynthesis of secondary metabolites
ftt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FTV_0429 (hemB)
Enzymes [BR:ftt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     FTV_0429 (hemB)
Exosome [BR:ftt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FTV_0429 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AFB80165
Position
478432..479406
Genome map
AA seq 324 aa AA seqDB search
MSFPISRPRRLRVTQAFRDIVAETTLSLDDLMYPIFVVHGQGVKKEISSMPNQYHWSVDM
LDELVDQVVKAGIRSLMIFGVPKIKDLVSSENYDPNGITQQAIRKIKQLAPELVIATDVC
MCSFTPHGHCGILDEHDYVDNDQTLEILQKTAVSHAQAGADIVAPSGMMDGMIIAMRQAL
DEASFENVSIMSYSVKYASAYYGPFRSACSSSLKGDRKTYQMDYRNKKEAICEALADIEQ
GADFIMVKPALSYLDIVNELSHIIDLPIAAYHVSGEYAMIKAAASAGLVDEKAITIETLI
SMKRAGAKVILTYTALDVANWLKV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagctttccaatatcacgtccacgtagacttagggttacacaagcttttcgcgatatc
gttgctgagacaactttaagccttgatgacttaatgtatccaatatttgttgtgcatggt
caaggagttaaaaaagaaatttcaagtatgccaaatcaatatcattggtcagttgacatg
cttgatgagttagtagatcaagttgtcaaggctggaataaggagtctaatgatatttggc
gtgccaaaaatcaaagatcttgtttcatcggagaattatgatcctaatggaataacacag
caagcaattagaaagattaaacaacttgctcctgagcttgtgatagctacagatgtatgt
atgtgtagttttacaccacatggtcattgtggaattttagatgagcatgattatgttgat
aacgatcaaacattagaaatattacaaaaaacggctgtttctcatgctcaagctggagca
gatattgtagcaccaagtgggatgatggatggtatgataattgcgatgcgtcaggcacta
gatgaggcaagctttgagaatgtgagtattatgtcatactcagttaaatatgcatcggca
tattatggaccatttagaagtgcttgtagttcgtcacttaagggagatcgtaaaacttat
cagatggattatcgcaataagaaagaggcaatctgtgaggcgcttgcagatattgagcag
ggtgcagattttattatggttaaaccagctttgagttatctggatattgtcaatgagtta
agtcatattatagatttaccaatagcagcatatcatgtcagtggtgaatatgcgatgata
aaagctgctgctagtgctggtttagttgatgaaaaagcaatcactatagaaacactcata
tcaatgaaaagagcaggtgctaaagtgatacttacatatactgcgttggatgtggctaat
tggttaaaggtttaa

DBGET integrated database retrieval system