KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0618Help
Entry
FTV_0618          CDS       T01761                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ftt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677570..678220
Genome map
AA seq 216 aa AA seqDB search
MISFIKGVLIEKDPTALLIDVNGIGYEVFVPMTTFYTLGDIDSQVSLYTHFVVREDAQQL
YGFKSKVDKKVFQELIKVNGIGARTAIAILSGMDSKTLLHCIENKDYALLATVPGIGKKT
AERLVVEIYDKLLKMANEIYAQTSGTTTTSQDSQAQQAPTSVVLANSIFNESVDALLALG
YKQKDAEKMARSAMGDATTVAEVIRKALQGSIKSKR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgataagttttataaaaggtgtattgatagagaaagatccaacagctttgcttattgat
gtaaatggtattggttatgaagtttttgtaccgatgacaacattttatacattaggtgat
attgatagtcaggttagcctttatacacattttgtagttcgtgaagatgctcagcaactc
tatgggtttaaatcaaaagttgataagaaagttttccaagagttaattaaagtcaatggt
ataggagctagaacagctattgctattttatctggtatggattcaaaaactctattacat
tgtattgaaaataaagattatgctttattagctacagtgccaggaattggtaaaaaaact
gctgagcgtttagttgtagaaatttatgataagttattaaaaatggctaatgagatttat
gctcagacttcaggtacaactacaactagtcaagattcacaagcacaacaggcaccaaca
tctgtagtattagcaaactcaatatttaacgaatccgttgatgcattattggcattaggc
tataagcaaaaagatgctgaaaaaatggctcgctctgctatgggtgatgcaactacagta
gcagaggtaattcgtaaagctctgcaaggatcaataaaatcaaaaagataa

DBGET integrated database retrieval system