KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0715Help
Entry
FTV_0715          CDS       T01761                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00040  Pentose and glucuronate interconversions
ftt00052  Galactose metabolism
ftt00500  Starch and sucrose metabolism
ftt00520  Amino sugar and nucleotide sugar metabolism
ftt01100  Metabolic pathways
ftt01130  Biosynthesis of antibiotics
Module
ftt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FTV_0715 (galU)
   00052 Galactose metabolism
    FTV_0715 (galU)
   00500 Starch and sucrose metabolism
    FTV_0715 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    FTV_0715 (galU)
Enzymes [BR:ftt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FTV_0715 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFB80420
Position
776865..777728
Genome map
AA seq 287 aa AA seqDB search
MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNK
KSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPL
VGIEDFAVILPDDLIYNHDCGTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKD
NDNLIKAIVEKPAPEKAPSTNAVVGRYLLPNKIFRCLESTSEGAGGEIQLTDAIAKLLDQ
DEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKFKEYLQNR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcagtttttcctgtagctggatggggcactagatttttaccagct
actaaatcatgtcctaaagaaatgctaacagttgttgataaaccattgatccaatatgct
gttgaagaggctatagaggcaggctgtaaagagataatatttgttactagctcaaataaa
aaatccctagaagatcattttgatagaaactttgaattagaatattcgctagaaaaaaaa
caaaaatatgaattgttagatttagtaaaaaatataattcctaaagatgtaagttttttc
tttgtacgtcagccagaggcgctaggactagggcatgcggttttatgtgcaaaaccacta
gttggaattgaggattttgcagttatattacctgatgatttaatttacaatcatgattgt
ggtactggtacgctaaagcaaatggttaaggcggtagaaggtactgatattagaggttgt
atcgcaactcaacaagtcaagagagaaaaaacaaattcatatggtatagttgcaaaagat
aatgataatctaatcaaagcaattgttgaaaagccagcaccagaaaaagcaccatcaact
aatgcagttgtgggtagatatttattaccaaataagatttttagatgtttagaatcaact
tcagagggcgcaggtggtgagattcaactaactgatgctatcgctaaattattagatcag
gatgagaaaattttgtcttatgaatttaagggtactcgttatgattgtggcagtaaatta
ggttttttaattgctaattatgagatagctttacagcatcaagagttaggacataaattc
aaagaataccttcaaaatagatag

DBGET integrated database retrieval system