KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0886Help
Entry
FTV_0886          CDS       T01761                                 

Definition
putative sugar kinase ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTV_0886
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTV_0886
   00052 Galactose metabolism
    FTV_0886
   00500 Starch and sucrose metabolism
    FTV_0886
   00520 Amino sugar and nucleotide sugar metabolism
    FTV_0886
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTV_0886
   00524 Butirosin and neomycin biosynthesis
    FTV_0886
Enzymes [BR:ftt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTV_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944102..944953
Genome map
AA seq 283 aa AA seqDB search
MVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGIG
VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK
QYENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKIGV
EDVEILKRARNNNKDAINIYKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAM
WDEIKTFAFTQSAKKIKIEWSETEGDFQVFGAAAVYLDRSSNL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtggttggtgttgatatcggtggcactaaagtgaatgctggtagggtatgtggagaaaat
ctattagactcttacttgagcaaaattccaccagatgcagaacataatgctcaatctgtt
attgatgttgtcataaatactatagcaaaagttttcacctctgaagtagaaggtattggc
gttgggattcctagtgttgcagatcgagaaaagggaattgtatatgatgtgcaaaatatc
aaatcatggcaagagattcatctaaaggaaatactagaggcagaatttaaagtaccagtt
tttatagataatgatgcaaactgttttgctattggacaaagactatatggtaaaggcaaa
caatatgaaaattttgttggtattacaataggtactggtattggtggaggaattataaat
aaaggctccttactaaaagactctaattgcggtgctggagaatttggcatgttgccatat
ctagatggaattttagaagattattgtagtggtcaattttttataaaaaagattggtgtt
gaagatgttgagattctcaagcgtgcaagaaataataataaagatgctataaatatctat
aaacaatttggtaaacatcttggagtagcaataaagtctattatgtatactctagaccca
gaagtgataataatcgcagggtcaataatatcagccagagagttttttgaaaaagcaatg
tgggatgagattaaaacatttgcctttactcaatcagctaaaaaaattaaaatagaatgg
tcagaaacggagggagattttcaggtttttggcgctgcagctgtttatttggatagaagt
agcaatttataa

DBGET integrated database retrieval system