KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_1346Help
Entry
FTV_1346          CDS       T01761                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase divergent Francisella type
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00860  Porphyrin and chlorophyll metabolism
ftt01100  Metabolic pathways
ftt01110  Biosynthesis of secondary metabolites
ftt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FTV_1346 (hemD)
Enzymes [BR:ftt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FTV_1346 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFB80987
Position
complement(1457610..1458359)
Genome map
AA seq 249 aa AA seqDB search
MKILVCRPQNDAVNLTEKLCANGLLAVSLPTIKICYQKITESVLDYTSLVFTSKYAVESL
FSQYPIYLFKNKKIYSVGASTAAILEKYQLAAIYPVRHGSQELLDIILNQDISKEKFAII
SGVSGNDLLLEELSKLTHCHKFETYLRVFIDLDELLDTYNKLFLHNQPDIIIATSLDVFK
SLNRIFEKITTPKAATITITSLKMLKFVNQQGFKNTLKLEKLDNSYICQRILEFTEAKDV
SRKKHPATK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactagtttgtcgccctcagaatgatgctgtcaatttaacagaaaaactctgt
gcaaatggtcttttagcagtaagtttaccaactatcaaaatttgttatcaaaaaattact
gagagtgttcttgactatacaagtctagtttttactagtaaatatgctgttgaaagcttg
tttagtcaatatccaatctatttgtttaaaaataaaaagatctatagtgttggtgccagt
actgctgctatattagaaaaataccaattagctgcaatatatccagttagacatggctca
caagaacttttagatatcatattaaatcaagatatttctaaagaaaagtttgcgattatt
tctggtgtctctggtaatgatcttttgcttgaagagttatcaaaattaacacactgccat
aaatttgagacgtatttacgagtttttatagatcttgatgagttgttagatacttataat
aaactttttttacataatcagccggatattataattgctacaagtcttgatgtttttaaa
tcattaaatagaattttcgaaaaaataactactccaaaggctgcaacaattaccataaca
agcctaaaaatgctaaaatttgttaatcaacaaggctttaaaaataccttaaaacttgag
aaactagataatagttatatctgtcaaagaatactagaatttacagaggcaaaagatgtc
agtagaaaaaaacacccagcaacaaagtag

DBGET integrated database retrieval system