KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_1415Help
Entry
FTV_1415          CDS       T01761                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00010  Glycolysis / Gluconeogenesis
ftt00020  Citrate cycle (TCA cycle)
ftt00620  Pyruvate metabolism
ftt01100  Metabolic pathways
ftt01110  Biosynthesis of secondary metabolites
ftt01120  Microbial metabolism in diverse environments
ftt01130  Biosynthesis of antibiotics
ftt01200  Carbon metabolism
Module
ftt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTV_1415 (aceF)
   00020 Citrate cycle (TCA cycle)
    FTV_1415 (aceF)
   00620 Pyruvate metabolism
    FTV_1415 (aceF)
Enzymes [BR:ftt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FTV_1415 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N NQRA HlyD_3 PTS_EIIA_1 DUF2118 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AFB81052
Position
complement(1534189..1536084)
Genome map
AA seq 631 aa AA seqDB search
MSIEIVKVPDIGDYDNVDVIEVNVAVGDVIAEEDSLITLETDKASMEVPSPFAGKITKLT
VKVGDKVSQGTAIMEVEVESAADQAATTQSQPQTTSSAPVAATTNLIVDVEVPDIGDYDS
VDVIEVSVKVGDEIAEEDSLITLETYKASMEVPSPVAGKVVEVITKVGDKVSQGSLILKV
ETGSSAQAPAQEQSQQSAPVKSAAEEIIDVKVPDIGDYDSVDVIEVSVAVGDKIEEEDSL
ITLETDKASMEVPSPVAGEVVEIITKVGDKVSQGSLILKVKTQGSAPVEQTSSQPAPAKQ
EQAKQQAATPAAPTPASSSVNEYAVDNSNAHASPAVRKLARILNIDLSKVKATGRKGRVT
KEDCYNYIKHAVTQVQTGKVAASGSGLDLLDDPVVDFAKFGEIETQPLSRINKISAKNLH
RNWVKIPHVTFYDDADVTDLEEFRNAKKAFAEKKGIKITPLSFLVKAAAVALQEFPRFNS
SLSNDGENLIIKKYYNIGFAADTPAGLMVPVVKDADKKGIIEISKDIMELAGKARDGKLG
AKDMTGATFTISSLGVLGTTSFTPIINMPEVAIMGVSKTAVKPIWNGKEFIPRTMLPLSL
STDHRVIDGALAAKFLTRYCQILSDLREIIM
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagagatagttaaagtccctgatattggggattatgataacgttgatgtgatc
gaggttaatgttgctgtaggtgatgttattgctgaagaagattcactaattacgttagaa
acagataaagcaagtatggaggttccatctccatttgcaggtaagatcactaaattaact
gtaaaagttggtgataaagtttctcagggaactgcaataatggaagttgaggttgagagt
gctgctgatcaagctgctactacacaatcacaacctcaaacaactagttcagctcctgta
gctgctacgacgaacctgattgttgatgtcgaggttccagatattggcgactatgatagt
gttgatgtgattgaggtgtctgtaaaagtaggtgatgagatagcagaagaggattcgcta
attacgcttgaaacatataaggctagtatggaagtaccatcgcctgtagcgggtaaggtt
gttgaagttattactaaggttggtgacaaggtttcacaaggtagcttgattttaaaggtt
gaaacaggctctagtgcacaagctccagctcaagaacagtcacaacaatctgcaccagtt
aaatccgctgctgaagaaattattgatgtaaaagttcctgatatcggtgattacgatagt
gttgatgtgattgaagtatctgtagctgttggtgataagattgaagaagaagattctttg
attacattagaaactgataaggcaagcatggaggttccgtctccagttgctggtgaagtt
gttgaaataatcacaaaagttggtgataaagtttcacaaggtagtttaattcttaaggtc
aaaacacaaggttcagcaccggtagagcaaactagttcacaaccagcgccagctaaacaa
gagcaagctaaacagcaagctgctacacctgctgctccaacgccagcatcaagttcggta
aatgagtatgctgtagataattctaatgcacatgcgtctcctgcagtgagaaagctagca
cgaattctaaatattgatctaagtaaggttaaagctacagggcgtaaaggtcgtgtaaca
aaagaagattgttataactatattaagcatgctgtcacacaagttcaaactggtaaggtc
gctgctagtggtagtggtttagatcttttagatgatcctgttgttgattttgctaagttt
ggtgagattgaaactcaaccattatcaagaattaacaagattagtgctaagaatttacat
cgtaactgggtgaagattcctcatgttacattctatgatgatgcggatgtcacagactta
gaagagttcagaaatgctaagaaagcctttgctgagaaaaaaggtattaagattacacct
ttatcattcttggttaaagctgctgcagttgcattacaagagttcccaagatttaatagc
tcattatcaaatgatggtgagaacttaattatcaagaagtattataatattggttttgct
gcagatactccagctggtttaatggttccagttgtcaaagatgctgataaaaagggtatc
attgaaatatcaaaagatattatggagttggctggcaaagctcgtgatggtaaacttggc
gcaaaggatatgacaggtgctacatttactatctcaagcttaggcgtgttaggtactacg
tcatttacgcctattataaatatgccagaggtggctattatgggtgtatctaagacagca
gtgaagcctatttggaatggtaaagagtttattcctagaactatgctaccattatcatta
tctacagatcatagagtgatagatggcgcattagcagctaaattcttaactagatattgt
cagattttatctgatttacgtgaaatcataatgtaa

DBGET integrated database retrieval system