KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_1688Help
Entry
FTV_1688          CDS       T01761                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00260  Glycine, serine and threonine metabolism
ftt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftt01100  Metabolic pathways
ftt01110  Biosynthesis of secondary metabolites
ftt01130  Biosynthesis of antibiotics
ftt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTV_1688 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTV_1688 (trpA)
Enzymes [BR:ftt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FTV_1688 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFB81292
Structure
PDB: 

Jmol
Position
1851312..1852121
Genome map
AA seq 269 aa AA seqDB search
MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEIIDTLVSSGADALELGIPFSDPLA
DGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLLYANLVYANGIENFYQKCL
DAGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSR
VGVTGTETAANMPVEDVLTKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVK
IIQNNISNKQKMLNELTYFVKEMKAATLN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatagatacacaaccctttttgcaaatttagagaaaagaaatgaaggagctttt
ataccttttgtaacaattggtgatcctaataaagcgctatcctttgaaattatcgatact
ttggttagttcaggtgctgatgctcttgagttgggtatacctttttcagatcccttagca
gatgggccaacaattcaagaagcaaatattcgcgctctggagagtggaataacccctaaa
gattgtttcgatattctaactaaaataagagcaaaataccctcatatccctattggttta
ctactttatgctaatttagtctatgcaaacggtatagagaacttttatcaaaaatgttta
gatgcaggtgttgattctatacttatagctgatgtacccgctcacgaatctaaagagttt
cgtgatattgctaaaaaagttggtatagcacaaatatttatcgctcctcctgatgctagt
gagtcaactcttaagcaaatttctgaacttggtagtggttatacgtatttactatcgaga
gttggtgtaacagggacagaaactgctgcaaatatgcccgtcgaggatgtattgactaaa
cttagagaatataatgctcctaaaccagttttagggtttggtatctctaaacctgagcaa
gtacaacaagctatcaaagctggtgctgctggtgcaatttcaggctcagcaacagtgaaa
attattcaaaataatatctctaataaacaaaaaatgcttaatgagcttacatattttgtt
aaagagatgaaagcagctacattaaactaa

DBGET integrated database retrieval system