KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0080Help
Entry
FTT_0080          CDS       T00214                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00010  Glycolysis / Gluconeogenesis
ftu00051  Fructose and mannose metabolism
ftu00562  Inositol phosphate metabolism
ftu01100  Metabolic pathways
ftu01110  Biosynthesis of secondary metabolites
ftu01120  Microbial metabolism in diverse environments
ftu01130  Biosynthesis of antibiotics
ftu01200  Carbon metabolism
ftu01230  Biosynthesis of amino acids
Module
ftu_M00002  Glycolysis, core module involving three-carbon compounds
ftu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTT_0080 (tpiA)
   00051 Fructose and mannose metabolism
    FTT_0080 (tpiA)
   00562 Inositol phosphate metabolism
    FTT_0080 (tpiA)
Enzymes [BR:ftu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FTT_0080 (tpiA)
Exosome [BR:ftu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FTT_0080 (tpiA)
  Exosomal proteins of bladder cancer cells
   FTT_0080 (tpiA)
  Exosomal proteins of melanoma cells
   FTT_0080 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PEP_hydrolase
Motif
Other DBs
NCBI-GeneID: 3191461
NCBI-ProteinID: YP_169155
UniProt: Q5NII7 A0A0H3TPT2
Structure
PDB: 

Jmol
Position
83407..84168
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVG
LQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT
PVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLEQ
IQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggtaactggaaaatgaatggtaactctacaagcataaaagag
ctctgtagtggtatatcacaagtgcaatatgatacttcaagagtagctattgctgttttt
ccatcaagtgtttatgttaaagaagtaatctcacagctgccagagaaagtaggtgttggt
ctacaaaatattactttttatgatgatggtgcttatactggtgagatatctgctaggatg
ttggaagatattggttgtgactacttactaattggtcattctgagagaagatctctattt
gctgagtctgatgaagatgtttttaaaaagcttaacaagattatagatactactataacg
ccagtagtgtgtattggtgaatcactagatgatagacaaagtggtaagctcaaacaagtt
ttagcaacacaactaagcttaatcttagaaaatttatctgttgagcagttagcaaaagtc
gtaattgcatatgaacctgtctgggcaataggcacaggagttgtggcttcactagagcag
attcaagaaacacatcaatttattcgttcattgttagctaaagttgatgaaagacttgct
aaaaatataaaaatagtgtatggtggtagcctaaaagctgaaaatgctaaagatatatta
agcttaccagatgtcgacggtggtttaattggtggcgcatctttgaaggctgctgaattt
aacgaaataataaatcaagcaaacaagatatgtacggaataa

DBGET integrated database retrieval system