KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0080Help
Entry
FTT_0080          CDS       T00214                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTT_0080 (tpiA)
   01230 Biosynthesis of amino acids
    FTT_0080 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTT_0080 (tpiA)
   00051 Fructose and mannose metabolism
    FTT_0080 (tpiA)
   00562 Inositol phosphate metabolism
    FTT_0080 (tpiA)
Enzymes [BR:ftu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FTT_0080 (tpiA)
Exosome [BR:ftu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FTT_0080 (tpiA)
  Exosomal proteins of bladder cancer cells
   FTT_0080 (tpiA)
  Exosomal proteins of melanoma cells
   FTT_0080 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83407..84168
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVG
LQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT
PVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLEQ
IQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggtaactggaaaatgaatggtaactctacaagcataaaagag
ctctgtagtggtatatcacaagtgcaatatgatacttcaagagtagctattgctgttttt
ccatcaagtgtttatgttaaagaagtaatctcacagctgccagagaaagtaggtgttggt
ctacaaaatattactttttatgatgatggtgcttatactggtgagatatctgctaggatg
ttggaagatattggttgtgactacttactaattggtcattctgagagaagatctctattt
gctgagtctgatgaagatgtttttaaaaagcttaacaagattatagatactactataacg
ccagtagtgtgtattggtgaatcactagatgatagacaaagtggtaagctcaaacaagtt
ttagcaacacaactaagcttaatcttagaaaatttatctgttgagcagttagcaaaagtc
gtaattgcatatgaacctgtctgggcaataggcacaggagttgtggcttcactagagcag
attcaagaaacacatcaatttattcgttcattgttagctaaagttgatgaaagacttgct
aaaaatataaaaatagtgtatggtggtagcctaaaagctgaaaatgctaaagatatatta
agcttaccagatgtcgacggtggtttaattggtggcgcatctttgaaggctgctgaattt
aacgaaataataaatcaagcaaacaagatatgtacggaataa

DBGET integrated database retrieval system