KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0271Help
Entry
FTT_0271          CDS       T00214                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FTT_0271 (ipk)
Enzymes [BR:ftu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     FTT_0271 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
286206..287033
Genome map
AA seq 275 aa AA seqDB search
MANIKAKKYYSYAKINLFLHILNKRPDGYHNLQTWFTFLDLKDQLTFSFNNSREINISSN
ISIAAKQDNLVYKAIKKFQQSYRVQDIGVDIEIKKNIPMGAGLGGGSSNAATTLIALRDY
YLPQLSNEEMIPLAAKLGADVPIFVYGKSAWAEGIGEILYHKDFSPQYALLIKPDIHIST
KEFFTSEDLIKSSVLISKDLGFDKSIMHNDFENVFYAKYPEFSQYLKELDSDFRMTGTGS
CFYLLSADKNKLEQLARKINKPLDKWLVKTLNYVY
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatataaaagctaaaaaatactatagttatgcaaagataaatctatttttgcat
atattaaacaaacgtccagatggttaccataatttacagacttggtttacctttttggac
ttaaaagatcaactaacttttagttttaataattcacgagaaattaatatttcgagtaat
attagtattgctgcaaaacaagataatttagtatataaggctatcaaaaaatttcagcaa
agctatagagtgcaagatataggtgttgatattgaaattaagaaaaatattccaatggga
gcaggacttggcggtggaagctcaaatgctgctactacacttatagctttacgtgattat
tatttgccgcagttgtcaaatgaggagatgattccattagcggcaaaacttggtgccgat
gtgccgatatttgtttatggtaaatctgcgtgggcagaaggtataggtgagatattatac
cataaggattttagtccgcagtatgcgctattgattaaaccggatatccatattagtaca
aaagagttttttacaagtgaggatttaattaagtcatcggttctaatatctaaagattta
ggctttgataagagcattatgcataacgattttgagaatgttttttatgcaaaatatcca
gagtttagtcaatatctaaaagagttagatagtgattttagaatgacaggtacaggttct
tgtttttatttactctcagcagataaaaataaacttgagcaacttgcaagaaaaattaat
aaacctcttgacaaatggctagtcaaaacattaaactatgtctactaa

DBGET integrated database retrieval system