KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0298Help
Entry
FTT_0298          CDS       T00214                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FTT_0298 (holC)
   00240 Pyrimidine metabolism
    FTT_0298 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FTT_0298 (holC)
   03430 Mismatch repair
    FTT_0298 (holC)
   03440 Homologous recombination
    FTT_0298 (holC)
Enzymes [BR:ftu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     FTT_0298 (holC)
DNA replication proteins [BR:ftu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     FTT_0298 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311816..312256
Genome map
AA seq 146 aa AA seqDB search
MMKIEFKVLQTQDINQMLEVLITEVVKEYALQKTIAILAPAGIAKQLDDKLWQDGQDSFI
PHHCAINAREYNQYNNIPILITDNLFITSGYDVLINIMDVAVDPQRVKVKELKEFVYQQD
SALQASRKKYVYYKKSNLEIITVQDN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaatagagtttaaggttttgcagacacaagatattaatcaaatgctagaagtg
ctgattactgaagttgtcaaagaatatgctttacaaaagacaattgcaatcttagcacca
gcaggtattgcaaaacaactagatgataaactatggcaagatggtcaagattcttttatc
ccacatcattgtgctataaatgctagagagtataatcaatataataatattccaattctt
atcacagataatctatttattacctcaggttatgatgttttaataaatattatggatgtg
gctgtagacccacagcgagttaaagtcaaagagctaaaagagtttgtctatcaacaagat
agcgctttacaggcttcacgtaagaagtatgtttactacaaaaaatcaaatctagagata
attactgttcaagataactaa

DBGET integrated database retrieval system