KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0312cHelp
Entry
FTT_0312c         CDS       T00214                                 

Gene name
folA
Definition
dihydrofolate reductase type I (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FTT_0312c (folA)
   00670 One carbon pool by folate
    FTT_0312c (folA)
Enzymes [BR:ftu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     FTT_0312c (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(327764..328264)
Genome map
AA seq 166 aa AA seqDB search
MISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKTFESIGRPLPNRKNI
ILTRDKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYKEFLKYADRLYITEVDA
EMTDLDAFFPQWDKSKYKRIGHKQFKKDDKNEFDFTFSVFEKNKNL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatctcactaatcgttgcttatgataaaaactttggtataggtaaagaaaatactcta
gcatggaaactatcagaagatcttaagaactttaaaaaaataacagaaaacaactatatt
gttatgggtagaaaaacctttgaatcgattggtcgcccactaccgaatcgtaaaaatatt
attttaactagagacaaagattacaaacaagataaatgtttaataataaatagtactcag
gatattttaaattttgctgaatcaaaaccacactacgaaatatttataatcggtggtgca
cagatctataaagaatttctaaaatacgcagatagattgtatataaccgaagttgatgca
gaaatgactgatcttgatgctttctttccacaatgggataaatcaaaatataaacgtatt
ggtcacaaacaattcaaaaaagatgataaaaatgagtttgactttacatttagcgtcttt
gaaaaaaataaaaatttgtaa

DBGET integrated database retrieval system