KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0658Help
Entry
FTT_0658          CDS       T00214                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ftu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677567..678220
Genome map
AA seq 217 aa AA seqDB search
MMISFIKGVLIEKDPTALLIDVNGIGYEVFVPMTTFYTLGDIDSQVSLYTHFVVREDAQQ
LYGFKSKVDKKVFQELIKVNGIGARTAIAILSGMDSKTLLHCIENKDYALLATVPGIGKK
TAERLVVEIYDKLLKMANEIYAQTSGTTTTSQDSQAQQAPTSVVLANSIFNESVDALLAL
GYKQKDAEKMARSAMGDATTVAEVIRKALQGSIKSKR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgatgataagttttataaaaggtgtattgatagagaaagatccaacagctttgcttatt
gatgtaaatggtattggttatgaagtttttgtaccgatgacaacattttatacattaggt
gatattgatagtcaggttagcctttatacacattttgtagttcgtgaagatgctcagcaa
ctctatgggtttaaatcaaaagttgataagaaagttttccaagagttaattaaagtcaat
ggtataggagctagaacagctattgctattttatctggtatggattcaaaaactctatta
cattgtattgaaaataaagattatgctttattagctacagtgccaggaattggtaaaaaa
actgctgagcgtttagttgtagaaatttatgataagttattaaaaatggctaatgagatt
tatgctcagacttcaggtacaactacaactagtcaagattcacaagcacaacaggcacca
acatctgtagtattagcaaactcaatatttaacgaatccgttgatgcattattggcatta
ggctataagcaaaaagatgctgaaaaaatggctcgctctgctatgggtgatgcaactaca
gtagcagaggtaattcgtaaagctctgcaaggatcaataaaatcaaaaagataa

DBGET integrated database retrieval system