KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0658Help
Entry
FTT_0658          CDS       T00214                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTT_0658 (ruvA)
Enzymes [BR:ftu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FTT_0658 (ruvA)
DNA repair and recombination proteins [BR:ftu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FTT_0658 (ruvA)
    RecFOR pathway proteins
     FTT_0658 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH 5_3_exonuc Transposase_20 HHH_3 IMS_HHH HHH_4 Cdd1
Motif
Other DBs
NCBI-GeneID: 3191358
NCBI-ProteinID: YP_169675
UniProt: Q5NH17
Position
677567..678220
Genome map
AA seq 217 aa AA seqDB search
MMISFIKGVLIEKDPTALLIDVNGIGYEVFVPMTTFYTLGDIDSQVSLYTHFVVREDAQQ
LYGFKSKVDKKVFQELIKVNGIGARTAIAILSGMDSKTLLHCIENKDYALLATVPGIGKK
TAERLVVEIYDKLLKMANEIYAQTSGTTTTSQDSQAQQAPTSVVLANSIFNESVDALLAL
GYKQKDAEKMARSAMGDATTVAEVIRKALQGSIKSKR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgatgataagttttataaaaggtgtattgatagagaaagatccaacagctttgcttatt
gatgtaaatggtattggttatgaagtttttgtaccgatgacaacattttatacattaggt
gatattgatagtcaggttagcctttatacacattttgtagttcgtgaagatgctcagcaa
ctctatgggtttaaatcaaaagttgataagaaagttttccaagagttaattaaagtcaat
ggtataggagctagaacagctattgctattttatctggtatggattcaaaaactctatta
cattgtattgaaaataaagattatgctttattagctacagtgccaggaattggtaaaaaa
actgctgagcgtttagttgtagaaatttatgataagttattaaaaatggctaatgagatt
tatgctcagacttcaggtacaactacaactagtcaagattcacaagcacaacaggcacca
acatctgtagtattagcaaactcaatatttaacgaatccgttgatgcattattggcatta
ggctataagcaaaaagatgctgaaaaaatggctcgctctgctatgggtgatgcaactaca
gtagcagaggtaattcgtaaagctctgcaaggatcaataaaatcaaaaagataa

DBGET integrated database retrieval system