KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0909Help
Entry
FTT_0909          CDS       T00214                                 

Definition
glutamine amidotransferase (EC:6.3.5.2)
Orthology
K01951  
GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ftu00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917768..918475
Genome map
AA seq 235 aa AA seqDB search
MKIAILQTDHIPEHRRGVAGGNYPEMFANLFFKLSVVVDFDIFDVTMQEYPQDYDIYDGF
IITGSKATAFDNLAWIIKLKTEIVKLHDNHKKIIGICFGHQILAQALGGRVERGPKGFAV
GVRNVEILTRKPWMEPFHSYLSLLFYHQDMVVKLPQGAELISTSDYCKVQMFCINNHILG
IQAHPEMLKVHKHALIKEYQDDIKNEFHHALESLRIRDNSLIIAHWMANFFEYKD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaattttacaaacagaccatatcccagaacatcgccgtggggttgccgga
ggtaattatccggaaatgtttgctaatcttttttttaagttatctgtagtggttgatttt
gatatttttgatgtaactatgcaggagtatccacaagactatgatatatatgatggtttt
atcataacggggagtaaagctacagcttttgataatcttgcttggattattaaattaaaa
acagaaatagttaagcttcatgataaccataaaaagatcataggtatttgttttggacat
caaattttagctcaagctctaggtggtagggttgaacgaggtcctaaaggatttgctgta
ggagtacgtaacgttgagattttaactagaaagccatggatggagccatttcatagttat
ttgagtttgttattttatcatcaagatatggtagttaaattacctcaaggagctgaactc
ataagtaccagtgattactgtaaagttcagatgttttgtataaacaatcatatcttagga
atacaagcccaccctgaaatgcttaaggtacataaacatgcacttattaaagaatatcaa
gatgatataaaaaatgagtttcatcatgctttagaaagcctaagaattagagataatagc
ttaataatagctcattggatggctaatttttttgagtacaaggattaa

DBGET integrated database retrieval system