KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0936cHelp
Entry
FTT_0936c         CDS       T00214                                 

Gene name
bioF
Definition
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00780  Biotin metabolism
ftu01100  Metabolic pathways
Module
ftu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FTT_0936c (bioF)
Enzymes [BR:ftu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     FTT_0936c (bioF)
Amino acid related enzymes [BR:ftu01007]
 Aminotransferase (transaminase)
  Class II
   FTT_0936c (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 3190975
NCBI-ProteinID: YP_169929
UniProt: A0A0G2RNL8 Q5NGB3
Structure
PDB: 

Jmol
Position
complement(947276..948403)
Genome map
AA seq 375 aa AA seqDB search
MLNLQDKYTQYQRDNLLRELTPFIKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFG
SKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYI
HASIIDGIKLSQAKLRRYKHQQLSQLQDIYDGKSFITTEGVFSTSGSITQLDKLAKITPE
KLIVDEAHSFGVLGKNGRGAINSFRISYKNCLICVFPLGKAFGGVGAVVCTTEAIAEYLI
QFARNYIYTTALPPMILKAALIQLKNLENANDNRARLQQNITFFNELCDAKDLELVSKDL
SPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQAL
EIISKEVKYEYIRSN
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacctacaagataaatatactcaatatcaaagagataatttattaagagagtta
actccttttataaaagatgactctattatagattttacaactagtgactatttaaatcta
tcatcagcacacaacttaaaacatgccatagtaaatggttttgataaatatggctttggt
agtaaaggatctaatatagtttgtggctatactgatgagacacaacagtttgaacatgag
tttgcaaagtttattaactatcctagagcaatattttttagttcaggttttatggcaaat
ttagcaatttattcaacactgtttagtaaacatgatagtatctttgcagataagtatatc
catgcatctattattgatggaatcaagctttcacaagctaagctaagaagatataaacat
cagcaattaagccaacttcaagatatttatgatggtaaaagttttataactacagaagga
gtttttagtacctcaggatcaattactcaacttgataagcttgctaaaatcacaccagaa
aagcttatagttgatgaagctcatagttttggagttttgggtaaaaatggtcgcggtgcg
atcaacagctttcgaataagctataaaaattgtctaatctgtgttttccctcttggtaaa
gcatttggtggagttggtgctgtggtttgtactacagaagcaattgcagaatatctaata
caatttgcgcgtaactatatctatacaacagcattaccaccaatgatattaaaagctgct
ttaatacaactaaaaaaccttgaaaatgctaatgataatcgagcaagacttcagcaaaat
atcactttttttaatgagttatgtgatgctaaagatcttgagttagtctctaaagattta
tctcctattagaagtattcaactaaataatgctaatctagcaattagattaaaagataag
ctctttgagaataaaataatagtatcttgttttagatatcctactgtacctaaagaccaa
gctatactaagattttcgctacatagtaataatacttttgatcagattcaacaagcttta
gaaattatttccaaagaggttaagtatgagtatatacgatcaaattag

DBGET integrated database retrieval system