KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_1132cHelp
Entry
FTT_1132c         CDS       T00214                                 

Gene name
glpQ
Definition
glycerophosphoryl diester phosphodiesterase (EC:3.1.4.46)
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    FTT_1132c (glpQ)
Enzymes [BR:ftu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     FTT_1132c (glpQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1144308..1145060)
Genome map
AA seq 250 aa AA seqDB search
MHVDKFISHRGANSDFIENTIEAFQIAKAAGFNWFETDVQMSSDGELFLFHDKTPKRFAD
CDKNVIEMTLAELKQIQLADSVLKVKAKIPTLREYLDWASENDVFTNLELKISTQDKKYQ
QKLVENVFKILQEYPNLKTKVLISSFSNFVMKLLKKYKDYPQGKLFYTVNWPRDFSYIDK
NLYKNYKQNRYLAIIINYSCLNQQRVNYLKRKFDKIFVYSVHTDCEAKQLLAWDIDAMFI
DKKEQLNLTL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtagataaatttatttctcacagaggtgccaacagcgattttattgaaaatact
attgaggcttttcaaattgctaaagctgctggttttaattggtttgaaactgatgttcag
atgagtagcgatggtgagttgtttctttttcatgacaaaacacctaagaggtttgctgac
tgcgataaaaatgttatagaaatgacactggctgaactaaaacaaatacaacttgctgat
tcagttttaaaagtaaaagcaaaaattcccactttgagagagtatcttgactgggctagt
gagaatgatgtttttacaaatcttgagcttaaaataagtactcaagataaaaaataccag
caaaagttagtggaaaacgtttttaaaatacttcaagaatatccaaatctgaaaacaaaa
gtattaatatcaagtttctcaaattttgtaatgaagcttttgaagaaatataaagattat
cctcaaggaaaacttttttatactgtaaattggcctagagactttagttatattgataaa
aatttgtacaaaaattataaacaaaataggtatctagcgattattattaactacagttgt
ttaaatcagcaaagagtcaattatttaaaacgcaaatttgacaaaatatttgtatattct
gttcatactgattgtgaagccaaacaactactagcatgggatatagatgctatgtttatt
gataaaaaagagcagctaaatctaactctgtaa

DBGET integrated database retrieval system