KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_1393cHelp
Entry
FTT_1393c         CDS       T00214                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ftu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1436929..1438797)
Genome map
AA seq 622 aa AA seqDB search
MLVYLMEMIMYKTFHKACEQLADIRAIDFFFAKEVFGLVKKTTPSMTTLSSESYPPFHGA
KGNDLEQKSNEILFHILMKLMHVYSHGHSCLKIADISNKTIFASEQSNQSDAKVGFKMPS
SDKIASILDNLNYDNLPIYFAKQYDSLYIKRLWNYENEIANFIKLKTIQNTQKDNRIEEV
VDKLFEPAGEINWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMLNQNQQRIAL
LAPTGKAAQRMTESLKNTLATVIPSSLTTESTIQKNDIFKQVQDELNSVAQYLNNLEAQT
IHRFLGLRPNSTYVKYNQQSKAPFDVIIVDEASMLDMNIFIKLIRAVADNTKLILIGDTN
QLPSVEAGSLLANFTHDKYGSITPYTTLLIKNYRSQQYINNLAASVLKGDVNIDSQQNEN
IKFHSLRNLDIYLREYAKRYSQLEKCRDYKEALTELNKFRILVANKNLEIGTDKLNQKIE
KFMSKPIDSNYKGKLIMITQNSYSLGLFNGDVGIMWPDDTGKLRAYFDGKDAKAFSLNML
PKYESVYAMTIHKTQGSEFDEIVIILPAEDNEALSKQLLYTAITRAKYKLTIISEQSSLR
DIAQKDIKRNSNISELVSLSTQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
ttgctagtttatttaatggagatgataatgtataaaactttccataaagcttgtgagcaa
ttagcagatattagagccatagattttttctttgctaaagaggtgtttggtttagtcaaa
aagactactccgtctatgaccactttatcaagtgagtcatatccaccctttcacggagca
aaggggaatgatttggaacaaaaaagtaatgaaattttatttcatattttgatgaagctt
atgcatgtgtatagtcatggtcatagctgtttgaagatagcagatatatcaaataaaact
atttttgcttcagagcaaagtaatcagagtgatgctaaagtaggctttaaaatgccaagc
tctgataaaattgcaagtattttagataacttaaattacgataatttacctatatatttt
gccaaacagtatgattctttgtatattaaaagattgtggaattatgaaaatgaaatagct
aactttataaaattaaaaacaatccaaaatactcaaaaagacaatcgtattgaagaagtt
gtagacaaactatttgaacctgctggtgaaatcaactggcaaaaacaggcggttatcaaa
agtctaaattataattttagtattatctcaggtggacctggtacaggtaagacaaccaca
gtcgcaaagcttttacttgctatacaaatgcttaatcaaaatcagcaaagaatagcgctt
ttagcaccaactggtaaggctgctcagagaatgacagagtcattaaaaaatactctagca
actgtcattccgtcaagcttgaccacagaatctactatacaaaaaaatgatatctttaaa
caagttcaggatgaacttaatagtgttgctcagtatcttaataatctagaagcacaaact
atacacagatttttaggcttaagaccaaactctacttatgttaaatataaccaacaatct
aaagctccattcgatgttattattgttgatgaagcttcgatgcttgatatgaatattttt
atcaagttaattagagctgtagcagataatactaagttgatattaataggtgatactaat
cagttaccatctgttgaggctgggagtcttttagcaaactttacacatgataaatatggt
agcattacgccatatacaacattacttatcaaaaactatcgttcacaacaatatataaat
aatcttgcagcctcagtcctaaaaggcgatgttaatattgatagtcaacaaaatgaaaat
attaaatttcatagtctaagaaatttagatatttatttaagagagtatgcaaagagatat
tcacagcttgaaaagtgccgtgactacaaagaggctcttacagagctgaataaatttaga
atacttgtggctaacaaaaacctagaaattggtacagataagttaaatcagaaaattgag
aagtttatgtctaagcctatagattctaactataagggtaaactaattatgataactcaa
aatagttattcattagggttatttaatggagatgtagggattatgtggcctgatgatact
ggtaagctccgagcatattttgatggtaaagatgctaaggcatttagtctaaatatgcta
ccaaaatatgaaagtgtttatgcgatgacaattcataaaactcaaggctcagagtttgat
gaaatcgtgattattcttccagcagaagataatgaagcgctaagtaaacaacttttgtat
acagctattactagagcaaaatataaattaacgattatatctgaacaaagtagcttaaga
gatattgctcagaaagatattaagagaaattcaaatatcagtgaattagttagcttgagc
actcaataa

DBGET integrated database retrieval system