KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_1470cHelp
Entry
FTT_1470c         CDS       T00214                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00230  Purine metabolism
ftu01100  Metabolic pathways
Module
ftu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FTT_1470c (gmk)
Enzymes [BR:ftu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FTT_1470c (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_23 AAA_22 MMR_HSR1 AAA_16 AAA_18 DUF4921 RsgA_GTPase ABC_tran AAA_29
Motif
Other DBs
NCBI-GeneID: 3192552
NCBI-ProteinID: YP_170406
UniProt: Q5NEY6 A0A0H3TP23
Position
complement(1521774..1522346)
Genome map
AA seq 190 aa AA seqDB search
MNNYIFIVSAPSGAGKSSLLKAFLATDIGKDNYAVAISHTTREPRVGEINSREYYFVTVA
EFEQLLSQDGFIEYAKVFKNYYGTSKAELDRLLALGKNIILEIDWQGAQQTRAIYGDRAK
SIFILPPSLDELRKRLEKRNTDSKETIDYRMEQAQSEISHADEYDYLLVNDDFSQSLEQF
CKYFEQNIQS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataactatatttttatagtttctgcaccatctggcgcgggtaaaagttctttacta
aaagcttttttagcaactgacataggcaaggataactacgctgtagcaatctcccacact
actagagagccacgtgttggcgagatcaatagtagagaatattattttgtcacagtagct
gaatttgaacaattacttagtcaagatggctttattgaatatgctaaagttttcaaaaac
tattatggtacatctaaagctgagcttgatagattgcttgcattaggtaagaatattatc
cttgagattgactggcaaggtgcacaacaaacacgtgctatttatggcgatagggctaag
agtatatttatattaccgccttctttagatgagttaagaaaacgtctagaaaaaagaaat
acagattctaaggagactatagattatcgtatggagcaagcacaatcagagatttcacat
gctgatgaatatgattatctgctggttaacgatgattttagccagtcattagaacaattc
tgtaaatatttcgaacaaaatatccaaagttaa

DBGET integrated database retrieval system