KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_1552Help
Entry
FTT_1552          CDS       T00214                                 

Gene name
ole1
Definition
Delta 9 acyl-lipid fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    FTT_1552 (ole1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    FTT_1552 (ole1)
Enzymes [BR:ftu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     FTT_1552 (ole1)
Lipid biosynthesis proteins [BR:ftu01004]
 Desaturase
  First
   FTT_1552 (ole1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1613139..1613966
Genome map
AA seq 275 aa AA seqDB search
METQSNKLTIVAFAIMHLACLAIFFVNYNITALVVFVVTFSARTFALTAGYHRYFAHKAF
QTSRVFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKDTDLHSPKNGIFQSHVGWVFES
RSDHVDPKFTKDWVKYPELVWIDKYAHVSFALYLVGLFALGSLISHFYPSLETSGLAFVF
WGGILSTVLLYHTTFSVNSICHIFGSKDYETDNSCNNWFIALITFGEGWHNNHHKFAYSV
RNNLKVWQIDITYMILCVLRKFRIVWDFKQPKKTI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacagtctaataaattgacaatagtagcatttgctattatgcacttagcctgc
ttggcaatattttttgtaaattataatattacagctctagttgtatttgttgttacattc
tcagctagaacatttgctttgacagctggataccatcgttactttgcacacaaagctttt
caaacctctagagtgtttcaatttatcttagcgttagtaggtacttgggcatcgcaaaaa
ggaccgctttggtggtcaggacatcatagatatcatcatatccattctgataaagataca
gacctacactcgcctaaaaatggtatctttcaatcacacgtaggctgggtttttgaatct
agaagtgatcatgttgatcctaaatttactaaagactgggttaagtatcctgagctagta
tggatagataaatatgctcatgtatcatttgctctatatctggtagggctttttgcttta
gggagcctaattagccacttttatccaagccttgaaacatctggactagcatttgtcttc
tggggagggatattaagtaccgtcttactatatcatactacttttagtgtaaactcaatt
tgccatatctttggatctaaagattacgaaacagataatagctgcaacaattggtttata
gctctaattacatttggtgaaggttggcataataatcatcataaatttgcttattcggtt
agaaataatcttaaagtatggcaaatagacattacctatatgattttatgcgtcttgaga
aagttcagaatagtttgggattttaagcaaccgaagaaaactatttag

DBGET integrated database retrieval system