KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_1574cHelp
Entry
FTT_1574c         CDS       T00214                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00900  Terpenoid backbone biosynthesis
ftu01100  Metabolic pathways
ftu01110  Biosynthesis of secondary metabolites
ftu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FTT_1574c (dxr)
Enzymes [BR:ftu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     FTT_1574c (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C NmrA Semialdhyde_dh DapB_N Sacchrp_dh_NADP RsbU_N
Motif
Other DBs
NCBI-GeneID: 3191554
NCBI-ProteinID: YP_170496
UniProt: Q5NEP6 A0A0H3TPT3
Position
complement(1636102..1637259)
Genome map
AA seq 385 aa AA seqDB search
MFKKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKLAELCQEFKPKFAVVPD
LSKKQKLQSLVTDVEVLVGESGLEKVSSLAEIDIVMSAIVGIAGLKPTFAAAKAGKKILL
ANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDNHDKKCLPEIDKIILTASGGP
FRDKQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVNKALEVIEAYWLFSVSADKIGVL
IHPQSVTHSMVRYVDGSYIAQLGVPDMKTPIANAMYYPKRGSVNVESLDFTKYQLTFREA
CFERFEALKIVFNNLQNKNYAANIVFNAANEELVAAFLNKKIKYLEIIEVNKKVTKELNF
ENPKNIEEVFEIDRKTREYVDSVLG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaactaagattactatattaggagctacaggatctataggtgatagcact
ttagctgttattagagagactaatgattttgaagtttttgcattaactgcatttagtaat
gttgaaaagctggcagagctatgtcaagagtttaagcctaaatttgctgtagttccagac
ttgtcaaaaaaacaaaagttacaatcattagttactgatgttgaggttttggttggtgaa
agtgggcttgaaaaagtatctagcttagctgaaattgatattgtcatgtctgctatagtt
ggtatagcagggttaaaaccaacctttgcagcagctaaagctggtaagaaaattttgctt
gctaataaagaatctttggtaacagcaggacacttgctgatagatgaggttgtaaagaat
aatgctcaacttattcctgtggatagtgaacataatgctatatttcagtgtattgataat
catgataagaagtgtttgccagagattgataagataattttaacagcatctggaggtcct
tttagagacaaacaactacatgagttaacggatgtaacacccgagcaagcatgcaatcat
cctaattggcaaatgggcagaaaaatatcggttgattcatcaactatggtaaataaagcg
ttagaagttatcgaagcgtattggcttttttctgtttcagctgataaaataggcgttctg
attcatccgcagagtgtaactcattctatggtcagatatgttgatggtagctatatagcg
cagttaggtgtgcctgatatgaaaacacctatagccaacgcaatgtactatccaaagaga
ggatcagttaacgttgagagcttagattttacaaaatatcagctaaccttcagagaagct
tgttttgaaagatttgaagctttgaaaatagtttttaataatttacaaaataaaaattat
gctgctaacatagtttttaatgctgctaatgaggagcttgtggctgcatttttaaacaaa
aaaattaaatatttagagataatagaagtaaacaaaaaagtaacaaaagagttaaatttt
gagaatccaaaaaatatagaagaagtttttgaaatagatagaaaaactcgtgaatatgtg
gattctgttttggggtaa

DBGET integrated database retrieval system