KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_1772cHelp
Entry
FTT_1772c         CDS       T00214                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00260  Glycine, serine and threonine metabolism
ftu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftu01100  Metabolic pathways
ftu01110  Biosynthesis of secondary metabolites
ftu01130  Biosynthesis of antibiotics
ftu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTT_1772c (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTT_1772c (trpA)
Enzymes [BR:ftu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FTT_1772c (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-GeneID: 3190980
NCBI-ProteinID: YP_170662
UniProt: Q5NE80 A0A0M1U4F0
Structure
PDB: 

Jmol
Position
complement(1861734..1862543)
Genome map
AA seq 269 aa AA seqDB search
MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEIIDTLVSSGADALELGIPFSDPLA
DGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLLYANLVYANGIENFYQKCL
DAGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSR
VGVTGTETAANMPVEDVLTKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVK
IIQNNISNKQKMLNELTYFVKEMKAATLN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatagatacacaaccctttttgcaaatttagagaaaagaaatgaaggagctttt
ataccttttgtaacaattggtgatcctaataaagcgctatcctttgaaattatcgatact
ttggttagttcaggtgctgatgctcttgagttgggtatacctttttcagatcccttagca
gatgggccaacaattcaagaagcaaatattcgcgctctggagagtggaataacccctaaa
gattgtttcgatattctaactaaaataagagcaaaataccctcatatccctattggttta
ctactttatgctaatttagtctatgcaaacggtatagagaacttttatcaaaaatgttta
gatgcaggtgttgattctatacttatagctgatgtacccgctcacgaatctaaagagttt
cgtgatattgctaaaaaagttggtatagcacaaatatttatcgctcctcctgatgctagt
gagtcaactcttaagcaaatttctgaacttggtagtggttatacgtatttactatcgaga
gttggtgtaacagggacagaaactgctgcaaatatgcccgtcgaggatgtattgactaaa
cttagagaatataatgctcctaaaccagttttagggtttggtatctctaaacctgagcaa
gtacaacaagctatcaaagctggtgctgctggtgcaatttcaggctcagcaacagtgaaa
attattcaaaataatatctctaataaacaaaaaatgcttaatgagcttacatattttgtt
aaagagatgaaagcagctacattaaactaa

DBGET integrated database retrieval system