KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0073Help
Entry
FTW_0073          CDS       T00495                                 

Definition
putative protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Brite
Enzymes [BR:ftw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     FTW_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82766..83386
Genome map
AA seq 206 aa AA seqDB search
MNFELARENMVKQQVLTEGLSLDGVAKVMADIPREIFLPRELRTLAYCDTNLVVNERELR
SPMFTARLIEALAIKVSDNVLKLGLESGYPVALIAKLCKSVELVDYDELGLAVARRQLAS
IGIYNVEFNSAEHITNIIKNGKKYNCIYISEVVTEDEIDESLLGLLETGGRLIFVVRTAI
CDKAYLITKTPKQTYEKSFLFNTYNK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgagcttgctagagaaaatatggtaaagcaacaggttcttactgaaggactt
tctttagatggtgttgctaaagttatggcagatattcctagagagatttttttgcctaga
gagcttcgaactttagcttattgcgacacaaatttagttgtaaatgaaagagaattaaga
agtccgatgtttacagctaggcttatagaagcattagccatcaaagttagtgataatgtc
ttaaaacttggtttggaaagtggttatccggtagctttaatagccaagttatgtaaaagt
gttgagcttgttgattatgatgagttagggttagccgtagcaaggcgtcagctagcaagt
attggtatatataatgttgagtttaatagtgctgagcatataactaatattataaaaaat
ggcaaaaaatataattgtatctacatatcagaagttgttactgaggatgagattgatgag
tcgttattagggcttcttgagactggcggtagactgatatttgtcgttagaacagctata
tgtgataaagcatacttaataacaaaaactccaaagcaaacatacgaaaagagttttctc
tttaatacatacaataagtaa

DBGET integrated database retrieval system