KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0086Help
Entry
FTW_0086          CDS       T00495                                 

Definition
aldose 1-epimerase family protein (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTW_0086
   00052 Galactose metabolism
    FTW_0086
Enzymes [BR:ftw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     FTW_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
95466..96305
Genome map
AA seq 279 aa AA seqDB search
MITIKNDNLLVEISELGAEVRAVINTSTEHGYMWSGVSPVLFPVVGKSHDNKIKYQGKEY
PMGNHGLARHTVFDIVLHSENSVILAMETSKEDYPFRLRFEVTYTLEVNKLITEYNIINL
DDGVASCGFGAHPAFACPFDDKHKFSDYEITFSEQKLDFHPITPEAFYTGETKHFKLSKI
ELDNHTFDNDALVYSGFTDKRVRLAEKGSNRYIEVTFDGFEYLGLWSKPKANAPYVCIEP
WCGRSDTLGMDVDIEYRIGNVDIEPQQNFSRSYTIEFGY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgattacaatcaaaaatgataatttattagtggaaatcagtgagctaggtgccgaagtt
cgcgctgttattaatacttctacagaacatgggtatatgtggtctggagtgtctccggtg
ctatttcctgtagtgggtaaatctcacgataataaaatcaaatatcagggtaaagaatat
cctatgggaaatcatggtcttgctcgtcatactgtatttgatattgttttacatagtgaa
aatagtgttatcttagctatggaaactagtaaagaagactatccatttagattaaggttt
gaagttacatacactcttgaagttaataaacttatcacagaatacaatatcataaatcta
gatgacggtgttgcatcatgtggctttggagctcatccagcatttgcttgtccttttgat
gataaacataaattcagtgattatgaaattacattttcagagcaaaaattagattttcat
cctattacaccagaggctttttatactggtgaaaccaagcatttcaaactatctaaaatt
gaactagataatcatacttttgataatgatgctcttgtgtatagtggtttcacagataaa
agagtcagattagctgagaaaggttcaaatcgttatattgaagttacttttgatggcttt
gaatatcttggcttatggtcaaaacctaaggctaatgctccgtatgtatgtattgagccg
tggtgtggtagaagtgatacattaggtatggatgttgatattgagtatcgtattggtaat
gttgacattgaaccacagcaaaatttctctcgttcatatactatagagtttggctattaa

DBGET integrated database retrieval system