KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0153Help
Entry
FTW_0153          CDS       T00495                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
ftw00020  Citrate cycle (TCA cycle)
ftw00310  Lysine degradation
ftw01100  Metabolic pathways
ftw01110  Biosynthesis of secondary metabolites
ftw01120  Microbial metabolism in diverse environments
ftw01130  Biosynthesis of antibiotics
ftw01200  Carbon metabolism
Module
ftw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTW_0153 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    FTW_0153 (sucB)
Enzymes [BR:ftw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FTW_0153 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 E3_binding RnfC_N QRPTase_N T2SSB GCV_H
Motif
Other DBs
NCBI-ProteinID: ABO46139
Position
164927..166396
Genome map
AA seq 489 aa AA seqDB search
MVELKVPMFPESVADGTLAQWNKNEGDFVNEGDILAEIETDKVVLEVPATSSGVLKGIKK
HAGDTVLSEESLAIIDTAVSTSEPNQQTTNQGNASEATATGQEIDIKAPVFPESVADGTI
SEWHKKEGEAVSEGDILAEIETDKVVLEVPATSNGVLTKILKTAGETVLSAELIAKITAG
GATATTKSEASVGVSQANNDPHLVPSARKAFNASGLDTAANIEGTGKKGRITSEDVKKAV
ASVNKPQQQTVVINQGARYEKRVKMTRLRQTIANRLVEVQHTNAILTTFNEVDMSAVMEL
RNKYKDMFVKEHDTKLGFMSFFIKAATEALKKFPDVNASIDGDEIVYHNYFDIGIAVGTD
RGLVVPVLRDTDTKSLAELEADVLDKAIKGRDGKLSLEDMQGGTFTITNGGTYGSMLSTP
IINSPQSAILGMHNIVERPVVVKGEIKIRPIMYLALSYDHRIIDGGTSVRFLKMIKELIE
DPNRILLQV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattaaaagtacctatgttcccagagtctgtagcagatggcacattagctcaa
tggaataaaaacgaaggtgactttgtaaatgagggcgatatcttggcagagattgagact
gataaagttgttctagaagtacctgcaacatctagtggtgttttaaaagggataaaaaaa
catgctggtgatacagtgctttcagaagagtcattagcgatcattgatactgctgtttct
acatctgaacctaaccaacaaactactaatcaaggaaatgcttcagaagcaactgctact
gggcaagaaattgatattaaggcgcctgtatttccagagtctgtagcagatggcacgatc
tcagagtggcataagaaagagggtgaggctgtttctgagggtgatatcttagcagagatt
gagactgataaggttgttctagaggttccggcaacatcaaatggtgttttgacaaaaata
ttaaaaacagcaggagagactgtactatctgcagagcttatcgctaagattacagcagga
ggcgcaactgctactacgaaatcagaagcttcggtgggagtttctcaagcaaataatgat
ccgcatctagtaccttcagcacgtaaagcttttaatgcaagcggcttggatactgctgct
aatatcgaaggtacaggtaaaaaagggcgtataacttctgaagatgtcaaaaaagcagtt
gcatcagtaaataaacctcaacaacagacagttgttataaatcaaggtgctagatatgaa
aaaagagtcaagatgactcgtctgcgtcagactatagcaaataggttagttgaggttcaa
catactaatgcaatcttaactactttcaatgaagtagatatgagtgcagttatggagctt
agaaacaaatataaagatatgtttgtcaaagaacatgatactaagcttggctttatgtct
ttctttatcaaagcagcaacagaagcacttaagaaattcccagatgtaaatgcctctatt
gatggtgatgagattgtttaccataattattttgatattggtattgctgtaggtactgat
aggggtctagtggtacctgtactaagagatacagatactaaatctctagctgaattagaa
gccgatgttttagacaaagcgattaaaggtcgtgatggtaaattaagccttgaagatatg
caaggtggtacatttacgattacaaatggcggaacttatggttcgatgttatctacgcct
attattaattcaccgcaaagtgctattttaggtatgcataatattgttgagcgtcctgta
gttgttaagggtgagattaagattcgtccaattatgtatttagcgttatcttacgaccat
agaatcattgatggcggtacatctgtaagattcttgaagatgatcaaagagctaattgaa
gatccaaatagaattcttctacaagtatag

DBGET integrated database retrieval system