KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0156Help
Entry
FTW_0156          CDS       T00495                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTW_0156 (tpiA)
   01230 Biosynthesis of amino acids
    FTW_0156 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTW_0156 (tpiA)
   00051 Fructose and mannose metabolism
    FTW_0156 (tpiA)
   00562 Inositol phosphate metabolism
    FTW_0156 (tpiA)
Enzymes [BR:ftw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FTW_0156 (tpiA)
Exosome [BR:ftw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FTW_0156 (tpiA)
  Exosomal proteins of bladder cancer cells
   FTW_0156 (tpiA)
  Exosomal proteins of melanoma cells
   FTW_0156 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
168323..169069
Genome map
AA seq 248 aa AA seqDB search
MGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVGLQNIT
FYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCI
GESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLEQIQETH
QFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEFNEIIN
QANKICTE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaaatgaatggtaactctacaagcataaaagagctctgtagtggtata
tcacaagtgcaatatgatacttcaagagtagctattgctgtttttccatcaagtgtttat
gttaaagaagtaatctcacagctgccagagaaagtaggtgttggtctacaaaatattact
ttttatgatgatggtgcttatactggtgagatatctgctaggatgttggaagatattggt
tgtgactacttactaattggtcattctgagagaagatctctatttgctgagtctgatgaa
gatgtttttaaaaagcttaacaagattatagatactactataacgccagtagtgtgtatt
ggtgaatcactagatgatagacaaagtggtaagctcaaacaagttttagcaacacaacta
agcttaatcttagaaaatttatctgttgagcagttagcaaaagtcgtaattgcatatgaa
cctgtctgggcaataggcacaggagttgtggcttcactagagcagattcaagaaacacat
caatttattcgttcattgttagctaaagttgatgaaagacttgctaaaaatataaaaata
gtgtatggtggtagcctaaaagctgaaaatgctaaagatatattaagcttaccagatgtt
gacggtggtttaattggtggcgcatctttgaaggctgctgaatttaacgaaataataaat
caagcaaataagatatgtacggaataa

DBGET integrated database retrieval system