KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0219Help
Entry
FTW_0219          CDS       T00495                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    FTW_0219 (glpK)
Enzymes [BR:ftw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     FTW_0219 (glpK)
Exosome [BR:ftw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FTW_0219 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226417..227925
Genome map
AA seq 502 aa AA seqDB search
MSTDFILAVDQGTTSSRAIIFDKKGNIRKIAQKEFTQIYPKSGWVEHDAMEIWGTQSGVM
REALEFGRVKPDQIAAIGITNQRETVVVWDKETGDPVYNAIVWQCRRTSSICDEIKRDPQ
FVKYIKENTGLVVDAYFSGTKVKWILDNVEGAREKANAGKLLMGTIDTWLIWNLTRGKVH
ATDYSNASRTMLFNINSLEWDKKILDYLNIPESMLPEVKNSSEVFGVTDSHTLGGAEIPI
AGVAGDQHAALFGHCCFEKGMAKNTYGTGCFALMNVGDKPVYSDEGLLTTIAWAENGKPT
YALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDSTNGVYLVPAFVGLGTPYWDMY
ARGTIVGITRDTKREHIIRAALEAIAYQAKDVLECMKEDTGLDLAGLRVDGGAVQNNFLM
QFQSDILQSEISKPKINEITGLGAVFLAGLAVGFWKDKQELKSILTTEKVFEPQKDSQAV
AHDYRGWKKAVERSKAWAECYS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagatttcatcttagctgtagatcaaggtacaacaagttcacgagcaattatc
tttgataaaaagggtaatataagaaagattgctcaaaaagaattcacacaaatatatcct
aaaagtggttgggtagaacatgatgcaatggaaatatggggtactcaaagtggcgtaatg
cgtgaggcactagagtttggccgcgttaagccagatcaaattgcagcaataggtattaca
aatcagcgcgagacagttgtagtttgggataaagaaacaggtgatcctgtctataatgct
atagtgtggcaatgtcgccgtacttcgagtatttgtgatgaaatcaaacgagatcctcaa
tttgtcaaatatatcaaagaaaatactggtctggttgtagatgcgtatttttcaggcact
aaagtaaaatggattttagataacgttgaaggtgctagagaaaaagcaaatgccggcaaa
ttattaatgggtactatagatacttggttgatttggaatctaactcgcggtaaagtgcat
gcgacagactatagtaatgcttcgcgcactatgttatttaatattaatagtttagagtgg
gataaaaaaatacttgattacttaaatattcctgaatcaatgttacctgaggttaaaaac
tcaagtgaggtttttggagttacagatagccatactttaggtggtgctgagattcctatt
gctggtgttgcaggagatcagcatgcagcattatttggtcattgctgttttgaaaaaggt
atggcaaaaaatacttatggtacgggttgttttgcgttgatgaatgtcggcgataagcca
gtttattcagatgaaggtttattgaccactatcgcatgggcagaaaatggtaagccaact
tatgctttagaaggtagtgtatttatagcaggagctgttattcagtggattcgtgatggt
ttgggactagtgcgttctgctgaggatagtgagtactatgctactaagattgattctaca
aatggtgtatatttggtgcctgcgtttgttggtcttggcacaccatattgggatatgtat
gctcgtggtacgatagttggcattacccgcgatacaaagcgtgagcatattattcgtgca
gctctagaggctatagcatatcaagctaaagatgtcttagaatgtatgaaagaggatacg
ggacttgatcttgctggtttgcgtgttgatggtggcgcggtacaaaataacttcctaatg
cagtttcaatctgatattttacaatctgaaatctcaaaaccgaaaataaatgaaattact
ggtttgggggctgtcttcttagctggtttagcagttggtttttggaaggataaacaagaa
ttgaaatctattcttacaactgaaaaagtttttgaaccgcaaaaagactctcaagctgtt
gctcatgattatagaggttggaagaaagcagtagaaagaagtaaggcttgggcagagtgt
tatagttaa

DBGET integrated database retrieval system