KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0238Help
Entry
FTW_0238          CDS       T00495                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ftw01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ftw01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
249228..250394
Genome map
AA seq 388 aa AA seqDB search
MNNNEIIHQTIEKQGSIVWKSVFGLLLLPLVALIAIPWYAMTYGFSTSDYVCLVVFYMLT
GVGITMGYHRLWSHKTYKANKIVSYALLLFGTAALQNSVIQWSSDHRKHHKDVDDPIKDP
YAATRGFWFSHFGWLLRHSSPDVQEIRGVNDLLKDKALVFQHNHYTVLAILSCFGLPALL
GFIFGFLSGHTLTAAWHSALGFLLLGGLLRVILVHHATFCINSLAHTIGKRPYSTKNTAR
DSWITAIVTGGEGYHNYHHAFAGDYRNGIRWFDLDPSKWFIAGLAKIGWCYDLKTTPKHL
IEIAKAKVKLEEALTKKNKTFHLGIEEKYAKLVANVKNMYNAKQEYLKAKKDNVLSKADI
KEIKSKYKDLKIEFIQAKKKYNKASTIA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatgaaataatacaccaaaccatagaaaaacaaggtagcatagtctggaag
agtgtttttgggttgctacttctaccattggtggcgcttatagctattccttggtatgct
atgacttatggcttttcaacatcagattatgtatgtctagtagtcttctatatgcttact
ggtgttggtattacaatgggttaccatagactgtggtcacataaaacatataaggcaaac
aaaatagtaagttatgctcttttattatttggcacagcagcactacaaaatagtgtaatt
cagtggtcttcagatcacagaaaacaccataaagatgttgatgatcctatcaaagatcca
tatgctgctacacgtggtttctggttttcacattttggctggttactaagacatagtagt
cctgatgttcaggaaatcagaggtgtaaatgatcttctaaaagataaggcactagtattt
cagcataatcattacactgttttagcgatattatcgtgttttgggttgcctgcattgcta
ggttttatattcggattcttgagcggtcatacacttacggctgcttggcacagtgcttta
ggctttttactattaggtggtctacttagagttatattggttcatcatgcgactttttgt
atcaactctctagcacatactattggtaaaagaccttattctacaaaaaatactgctagg
gatagctggataacagctatagtaacaggtggtgagggttatcataattatcaccatgct
tttgctggtgattatagaaatggtattagatggtttgatttagacccatctaagtggttt
attgctggcttagctaagattggttggtgttatgatcttaagacaacacctaagcattta
attgaaattgctaaagcaaaagttaaattagaagaagcattaactaagaaaaataaaact
ttccatctaggtattgaagagaagtatgctaagcttgttgcaaatgttaaaaatatgtat
aacgctaagcaagagtacttaaaagctaagaaagataatgttttatctaaagctgatatt
aaggagattaaatcaaaatataaagatttaaaaatcgaattcattcaagctaagaaaaaa
tataataaagctagtactatcgcctaa

DBGET integrated database retrieval system