KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0419Help
Entry
FTW_0419          CDS       T00495                                 

Gene name
wbtH
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ftw00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417083..418969
Genome map
AA seq 628 aa AA seqDB search
MCGVVGFYSFNKEEGFDSIINQSLLSIKHRGSDDSGYWCDNQVTLGHTRLSIHDITNAGH
QPMLSNSGNTAIVFNGEIYNYLSIKNQLLSEYSNLKFKSNSDTEVLVNAIELWGIDKTLE
KCIGMFAFGVYSRKTSCLILARDRFGEKPLYFGIQNGILGFASELKALKPLKECGWRFDI
DRDALATYMRYAYVPTPYSIYKNISKLNVGSYIKFDAKGNSKEYKYWDSKKVLDSEKYKD
SYDQAILDLEIKLKSTLSIQMQSDVPLGAFLSGGIDSTTVVALMQSMSKDKINTFSIGFN
QKEYNEAEHARAVAKHIGTNHTDMYVTERDALDVIPKLAGIYDEPFADSSQIPTYLVSKI
AKSKVTVALSGDAGDELFGGYNRYFLAPNIAKKIKFAKLLKYAPDAWIKKAEILNFGKFA
LLADKLLKLKRVLEKAKTNKELYVLLCSQINDTSFVLGAKEYDILRDKNIYDIPQLSFQE
WMMFVDSNTYMIDDILVKVDRAAMANSLETRVPFLDHNIYEFAYSLPIDYKIQRGNGKRI
LKDLLYKYVPESLVNRSKMGFGIPLAKWLREDLREWADNLLDYSKIDKQGYLSPEVVQKY
WQEHLSGKRNWQAILWNILIFQEWLDNE
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggagtagtaggcttttactcatttaataaagaagaaggttttgactcaataatt
aatcaatcattgctttctataaagcatagagggtcggatgatagtgggtattggtgcgac
aatcaagttactctggggcatactagattatcaatacacgatataactaatgcgggacat
cagccaatgttatctaatagcggtaatactgctattgtgtttaatggagaaatatataat
tacttatccataaaaaatcagctattaagtgaatattcaaatcttaaatttaaaagtaac
agtgatactgaggttttggtcaatgctattgaactttggggtatagataaaactttagaa
aaatgcataggaatgtttgcttttggagtttacagtagaaaaactagttgtttaatacta
gctagagatagatttggcgagaagccattatattttggtatccaaaatggtattttgggt
tttgcatcagaattgaaggcacttaagccattaaaggaatgtggctggaggtttgatata
gatagagatgctttagcaacatatatgaggtatgcttatgtaccaacaccatactctatt
tataaaaatatatctaaactaaatgtaggtagttacataaaatttgatgctaaaggtaat
agtaaagagtataaatattgggattctaaaaaagtactagattcagaaaaatataaagat
tcgtatgatcaagcaatcctagatttagaaattaagcttaaaagtacactatcaatacaa
atgcagtcagatgttcctctaggagcatttttatccggaggaattgactcaacaactgta
gttgctcttatgcaaagtatgtctaaagataagataaacacttttagtataggttttaat
caaaaagaatataatgaagctgagcatgcaagagcagtagcaaaacatataggtacaaac
cacacagatatgtatgttacagaaagagatgctcttgatgtaataccaaaacttgctgga
atatatgacgagccctttgctgattcatcacaaataccaacgtatcttgtgagtaaaata
gctaagtcgaaagtaacagttgcactatcaggtgacgctggtgatgagctctttggcggt
tataatagatactttttagcaccaaatattgctaaaaaaatcaaatttgctaagttactt
aaatatgcaccagatgcttggataaaaaaagctgagatattaaattttggtaagttcgct
ttattagcagataaactactaaaactaaaaagagttctcgaaaaagcaaaaacaaataaa
gagctttatgtactactttgttcacaaataaatgatactagctttgtgttaggagcaaaa
gagtatgatatattaagagataagaatatttatgatattccacaattatctttccaagag
tggatgatgtttgttgattctaatacatatatgatagatgatatattggttaaggttgat
agagcagctatggctaactctctagagacaagagtgccatttttagatcataatatttat
gaatttgcttattccttaccaattgactataaaatacaacgaggtaacggaaaaagaatt
ttgaaagatttgttatataaatatgtgccagaaagtttggtcaataggtctaagatgggg
tttggtattccgcttgctaaatggttaagagaagatttacgagagtgggcagataattta
ctggattatagtaaaatagacaagcaaggttacttaagtcctgaggtggtgcaaaaatat
tggcaagagcatttgagtggtaaaagaaattggcaagcaatattatggaatattctaatt
tttcaggagtggttagataatgagtaa

DBGET integrated database retrieval system