KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0606Help
Entry
FTW_0606          CDS       T00495                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTW_0606 (recR)
DNA repair and recombination proteins [BR:ftw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FTW_0606 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(600971..601573)
Genome map
AA seq 200 aa AA seqDB search
MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKC
VYCQALTEDDVCNICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGI
GPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFISQMIAKDIKISRIGFGVPFGG
ELEYLDQQTLLHAFNARTNI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaaattttttctccgaaaattagcgctgtaatagaatctttgcgtaagcta
ccaactattggtaaaaaatcatcacaaagacttgctctatatctactagataaatcacct
gaaacagcaatagctattgccaactcgcttttagatgccacagcaaatatcaaaaaatgt
gtatattgccaagcacttactgaagacgatgtttgtaacatatgtagtaacactaatcga
gatgataccaaactatgtataatagaaagtatgcttgatatgattgctattgaagaggct
ggtatctatagaggtaagtattttgtattaaatggtagaatttctccactagatggcata
ggtccaagtgaattaaagctagatatcttacaacaaattatcgctgatagaaaaatcgat
gaggtaattcttgcaattagcccaactgtagaaggtgaaacaacagctcattttatttca
caaatgattgccaaagatataaaaatctcacgcatcggttttggagtaccatttggtggt
gaattagaatacttagatcaacaaactttactacatgcttttaatgcaagaactaatatt
taa

DBGET integrated database retrieval system