KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0638Help
Entry
FTW_0638          CDS       T00495                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    FTW_0638
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FTW_0638
Enzymes [BR:ftw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FTW_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
627399..627869
Genome map
AA seq 156 aa AA seqDB search
MSIYDFKLTANDGSEYHLPKNKVLLIVNVASKCGFTKQYRGLQHLHKIYPDLEIVAFPCN
SFGGQEPGSDEEIKNFCETNYNVTFPIMKKTKVNGKDAEPLFEYLKERAKGVLGTEAIKW
NFTKFLVSKDGETIVRYAPKTIPEDLIPDIDNFLKD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttatgactttaagctaactgcaaatgatggttcagaatatcatctgcctaaa
aataaagtgcttttgatagttaatgttgcgagtaagtgcggttttactaagcagtataga
ggtttgcaacatttacataaaatatatccagatttagaaattgttgcattcccttgtaat
tcatttggtggacaggagccaggtagtgacgaagaaatcaagaatttctgtgaaactaat
tataatgtcacatttccaattatgaaaaaaaccaaagtaaatggtaaagatgctgagcca
ttgtttgagtatctcaaagaaagagcaaaaggagtcttaggaactgaagctataaagtgg
aattttactaagtttttagtatcaaaagatggcgagaccatcgtaagatatgcacctaaa
actattccagaagatttaattccagatattgataattttctaaaagactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system