KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0741Help
Entry
FTW_0741          CDS       T00495                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ftw00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ftw00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
718605..719909
Genome map
AA seq 434 aa AA seqDB search
MKAVRVKKLSKLADEITINISGAKNALLHLIFASLIPDTKTKFTNVPTTLLDYKGAKEIL
ENVGAKVIEKDEEVTIDTAAISNETLELCGEMTSKTRCSLMLLGSLLKKKGRVKIGFPGG
CSFSEKRPFDIHLNGLEALGAEVKLADDHIEVIYKEEKNAEFKMPFPSVGATMNLLMYAV
TGNSEVVLENVALEPEVVTLIDYLNQCGANIDFDADSRKIKILGVMRLNGCEFEIIFDRI
QAMTYAAMAYLYKTNVTITNINTQDTYSIKKPLEKLTNAGAKWEYNQANRSIKFFGKDSC
IKGVDIIAAPFPHFPTDLQPIYAVMLFMANSSSTIQDTVYPERINYVYQIRKMGFNISID
NTLIKINPLKNLNDIRPAVMSVKDLRAGMACLMAGSLLDEFSTINNAHQIFRGYNNLIEN
MSHFMRIEILNDNV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtaagagtaaaaaagttaagtaagcttgctgatgagataactattaacatt
agtggtgcaaaaaatgctttgttacatctaatttttgcaagcttaattccggatactaaa
acaaaatttactaatgttccaacaactcttttagattataaaggggctaaggagatctta
gaaaatgttggtgctaaagtcattgaaaaggatgaagaagtaactattgatactgcagct
atttcaaatgaaactttagaactatgtggggaaatgacatctaaaacacgttgctctttg
atgcttttaggttcattgcttaagaaaaaaggtcgtgttaagattggttttcctggtggt
tgtagttttagtgaaaaaagaccttttgacatacacttaaatggattagaagcattaggt
gctgaggttaagttggctgatgatcatatagaggtaatttataaagaagaaaaaaacgca
gagtttaaaatgccttttccatcggttggcgcaactatgaatttactaatgtacgccgtg
acaggtaattctgaggttgtacttgaaaatgttgctttagagcctgaggttgttacatta
atagactatcttaatcaatgtggtgcaaatattgattttgatgctgatagcagaaaaata
aaaatcttaggtgttatgagattaaatggctgtgagtttgaaattatttttgaccgtatt
caagctatgacctatgccgctatggcgtatctgtacaaaacaaacgttacaattacaaat
attaatactcaagatacatacagtatcaaaaagcctttggaaaaattgactaatgcagga
gctaaatgggagtataaccaagctaatcgtagtattaagttttttggtaaggatagttgt
attaaaggagttgatataattgctgcacctttcccacattttcctaccgatttacagcca
atatatgcagtaatgttatttatggcaaatagctctagtactattcaagatacagtttac
cctgagcgcataaattatgtgtatcaaattcgtaaaatgggttttaatatatctatagat
aatactcttataaaaataaatccacttaaaaacctaaatgatatacgtccagcagtgatg
agtgtcaaagatttacgtgctggtatggcatgcttaatggctggatcattattagatgaa
ttttcgactattaataatgctcatcagatatttagaggttataataaccttatagaaaat
atgtctcattttatgcgaatagagattctaaatgataatgtttag

DBGET integrated database retrieval system