KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0752Help
Entry
FTW_0752          CDS       T00495                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
ftw00010  Glycolysis / Gluconeogenesis
ftw00052  Galactose metabolism
ftw00500  Starch and sucrose metabolism
ftw00520  Amino sugar and nucleotide sugar metabolism
ftw00521  Streptomycin biosynthesis
ftw01100  Metabolic pathways
ftw01110  Biosynthesis of secondary metabolites
ftw01120  Microbial metabolism in diverse environments
ftw01130  Biosynthesis of antibiotics
ftw01200  Carbon metabolism
Module
ftw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTW_0752 (glk)
   00052 Galactose metabolism
    FTW_0752 (glk)
   00500 Starch and sucrose metabolism
    FTW_0752 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    FTW_0752 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTW_0752 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FTW_0752 (glk)
Enzymes [BR:ftw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTW_0752 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase DUF3310 ROK Statherin
Motif
Other DBs
NCBI-ProteinID: ABO46632
Position
727125..728141
Genome map
AA seq 338 aa AA seqDB search
MYILSGDIGGTNTRLEVSLLENGATQSIAIRKYKGANFNCLSDIIDKFLSEVDLVGQIDS
VCLAVAGFVSNGEVEVTNLPWMVSEQYISEGLGIDKTKVKVINDFEAIGYGIESLDREKD
IITIQEGKKDDDNLCAVVGAGTGLGMCLVSYDKDDKPRVYKTEGGHVDFSPVDDEQVELF
KFMRKTFHRISPERFCSGYGIYNIYKYVVRHPLYDQPECMELRRALFSVSDSDKAAVIVK
YAIEHREPSALRTIDIFLSIYGSVAGNLALTSLPFRGLYIAGGIAPRLIKQIKESKFLEK
FRDKGRMSNMMKDFPVHIIMNTDVGLIGARTYAAGLVK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtatatattatcaggagatattggtggcactaacactagattagaggtttctctttta
gagaatggtgcgacacaaagtatagctataagaaagtataaaggtgcgaatttcaattgt
ttatctgatattattgataagtttttatctgaggtggacttagtaggtcaaatagattct
gtttgtcttgcagtagctggatttgtctctaatggtgaagttgaagtgactaatctgcca
tggatggtttctgagcaatatatctcagaaggacttggtatagacaaaactaaggttaaa
gtgattaatgactttgaagcaattggttatggtatagaatctctagatagagaaaaagat
ataatcacaatccaagaaggtaaaaaagatgatgataacttatgtgctgtagttggtgct
ggtacaggtttgggaatgtgtttagttagctatgataaagacgataagccaagagtttat
aaaacagaaggaggtcatgtggatttctcacctgttgatgatgaacaagttgagttattt
aagtttatgcgtaagactttccatcgtatctctcctgagagattctgtagcggctacggc
atttacaatatttataagtatgtggtgcgtcatcctttatatgatcaacctgaatgtatg
gagttacgtagagcattatttagtgtttcagactctgataaggcagcagtaattgttaag
tatgctattgagcatagagagccatcagcattaaggacgatagatatattcttaagtata
tatggctcagttgctggtaatttagcacttacaagtttaccttttagaggtctttatatt
gctggaggtattgcacctaggctcatcaagcaaataaaggagagtaaattcttagagaag
tttagagataaaggtagaatgtcaaacatgatgaaagattttccagtgcatataattatg
aacacagatgtcggtttaataggcgcacgtacgtatgctgctgggctagtaaagtaa

DBGET integrated database retrieval system