KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_1561Help
Entry
FTW_1561          CDS       T00495                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
ftw00020  Citrate cycle (TCA cycle)
ftw00640  Propanoate metabolism
ftw00660  C5-Branched dibasic acid metabolism
ftw01100  Metabolic pathways
ftw01110  Biosynthesis of secondary metabolites
ftw01120  Microbial metabolism in diverse environments
ftw01130  Biosynthesis of antibiotics
ftw01200  Carbon metabolism
Module
ftw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTW_1561 (sucC)
   00640 Propanoate metabolism
    FTW_1561 (sucC)
   00660 C5-Branched dibasic acid metabolism
    FTW_1561 (sucC)
Enzymes [BR:ftw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FTW_1561 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABO47272
UniProt: A4IZC2
Position
1467951..1469114
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKDLLESYGLKVQKGIVAHNPNEAAQAFDQLGGKFAVVKAQVHAGGRGKAGGV
KVVKSSQEAREVAESLIGKNLVTFQTDAEGQPVNSVGVFEDVYPVTRELYLGAVVDRSSR
KVTFMASTEGGVDIEEVAHNSPEKILKVEVDPLVGLQPFQAREVAFKLGLEGKQINDFVK
TMLGAYKAFIECDFALFEINPLAVRENGEIVCVDGKINLDSNALYRHPKLLALRDKSQEN
AKELKASEHELNYVALKGNIGCMVNGAGLAMATMDIIQLYGGKPANFLDVGGGATKERVI
EAFKLILDDENVKAVLINIFGGIVRCDMIAEAIIEAVKEVNVTVPVVVRLEGNNAEKGAK
ILADSGLKLIPADGLADAADKVVKSLG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaagctaaagatcttttagaaagctatggtctaaaagttcaa
aaaggtatcgtagctcataacccaaatgaagctgctcaagcatttgaccaattaggtggc
aaatttgctgtggttaaagctcaggtacatgctggtggtcgtggtaaagctggtggtgta
aaggttgttaaatcatctcaagaagctcgtgaagtagcagaaagcttaatcggtaaaaat
cttgttactttccaaactgatgctgaaggtcagccagttaattctgtaggtgtatttgaa
gatgtataccctgttactcgtgagttataccttggtgcggtagttgatagatctagccgt
aaagtaacattcatggcttcaactgaaggcggtgtagatattgaagaagttgcacacaac
tctcctgaaaaaatccttaaagtagaagtagatcctttagttggcttacaacctttccaa
gctcgtgaagtagctttcaagcttggtctagaaggcaagcaaatcaatgattttgttaaa
actatgctaggcgcttacaaagcattcatcgaatgtgattttgccctatttgaaatcaac
cctcttgcagttagagaaaacggagagattgtctgtgttgatggtaaaatcaaccttgat
tcaaatgctctttatagacaccctaaacttttagctctaagagacaaatctcaagaaaat
gctaaagaacttaaagcttcagagcatgagctaaactatgtagctcttaaaggtaacatc
ggttgtatggtaaacggtgctggtctagcaatggctactatggatattatccaattatac
ggtggtaagcctgctaacttcctagatgtaggtggtggtgctactaaagagagagtaatc
gaagctttcaaactaatcctagatgatgaaaatgtaaaagctgttttaattaacatcttc
ggtggtattgttcgttgtgatatgatcgctgaagcaattattgaagctgttaaagaagta
aatgtaactgtaccagtagttgttcgtctagaaggtaacaatgcagaaaaaggtgctaaa
atattagctgattcaggtttaaaactaatacctgctgatggtttagctgatgctgctgat
aaagttgtgaaatcactaggttaa

DBGET integrated database retrieval system