KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_1660Help
Entry
FTW_1660          CDS       T00495                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FTW_1660 (glgB)
Enzymes [BR:ftw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FTW_1660 (glgB)
Exosome [BR:ftw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FTW_1660 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1568248..1570170
Genome map
AA seq 640 aa AA seqDB search
MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSIC
VIGDFNYWQVEDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNHYVYKSDPYAFF
SELRPNTASIITTETQYTWSDDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDE
LSETLPQYIKEMGYTHVEFMPLHEHPLDASWGYQPTGFYSVNSRHGDIIGLKRLVDKLHN
NDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAINKGWGTHNFDLGRNEVKCFLI
SNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIYGGHENLEGIAFLKELNGVLK
HTCKGVITIAEESSSWPDISTPIEKGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIF
MGSEFVQFVEWREYEQLQWQVVDQYESHKQTLHFFKKLNDFYHNETALWQCDYNHHGFRW
IDADNSQQSILSFIRSSKDNKQKLIFICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFG
GSGQVMATEIFSSPQSSHGFEQRITIKIPPMATLVLKLIK
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaaattcagaacaaaatactcactctactattggcgaacaagatattcat
tacttccatgaaggtaagcatatatatgcatatgaatttatgggggctcacaaagcatgt
gaagaagggattgaaggtattagatttacaacatgggctccaaatgcgaaaagtatttgt
gttataggtgactttaactattggcaagttgaagataaaaactatatggaacctatcact
gatgctggactatggagtgtttttatcccaaatgcaaaaaatggtgataaatataagttt
gtagtaactaataaagatactaatcattatgtctataaaagcgacccttacgcttttttc
tctgaactaagaccaaatacagcttctataatcactactgaaactcaatatacctggagt
gatgataaatggctagaaaagcgcgctaaaactaactactatgataaccccatgaatgtt
tatgagctacatttagcctcatggaaaactaaaaatggtaaattcttgacatatgatgag
ctaagtgaaactctacctcaatatatcaaagaaatgggctatactcatgttgaatttatg
ccgttacacgagcatcccttagatgcttcatggggctatcaacctactggcttttattct
gtaaatagccgtcatggagacataattggcttaaagcgcctagtagataagctacacaat
aatgacataggcgtaattctagattgggttccagggcatttctgtaaagatcaacatggt
ttaatatactttgatggaagtccatgttatgagtatcaagagcctacaaaagcaatcaac
aaaggttggggaacacataattttgacttaggcagaaatgaagtaaaatgctttttgatt
tcaaatgcaatgtactggattaatgagtttcatatagacggcttacgtgttgatgcagtg
tcaaatattctttatcttaattatgatagagaagatggtcaatggataccaaatatttat
ggcggtcatgaaaaccttgaaggtatagcttttcttaaagaactaaatggagttctaaaa
cacacctgcaaaggcgttattactattgctgaagaatcttcctcttggccagatatttca
acccccattgaaaaaggcgggttaggatttgactttaaatggaatatgggatggatgaat
gataccttaaggtatatctcgctagatccggtttatcgtaaatatcatcataacttgata
actttttccatggtctatcattattcagaaaagtttattctttcgatctcgcatgatgag
gtagttcatggcaagaaatctttgattaataaaatgtggggagacttgtggaataaatat
gctggactacgtttatatatgtcatatatgattgggcatcctggtaaaaagcttattttc
atgggtagtgagtttgtccaatttgtcgaatggcgcgaatacgaacaactccaatggcaa
gtagttgatcaatacgaatctcacaaacaaactctacattttttcaaaaaattaaatgat
ttctaccataatgaaactgcactgtggcagtgtgactataatcatcatggtttcagatgg
atagacgctgataactcgcagcaaagtatcctatcttttattagaagtagtaaagataat
aaacaaaagctaatttttatttgtaacttcactccagttacatattatgactatcattta
ggagtaccagatgcaggatcatacaaagaggtatttaactcagataaccttgaatttggt
ggttctggacaagttatggctacagagattttctcgtcaccacagtcatcacatggattt
gagcaaagaattacaatcaaaatccctcctatggcaacactcgtactcaaacttattaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system