KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_1770Help
Entry
FTW_1770          CDS       T00495                                 

Gene name
folA
Definition
dihydrofolate reductase type I (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FTW_1770 (folA)
   00670 One carbon pool by folate
    FTW_1770 (folA)
Enzymes [BR:ftw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     FTW_1770 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1663588..1664112
Genome map
AA seq 174 aa AA seqDB search
MTKNRFLKMISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKTFESIGR
PLPNRKNIILTRDKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYKEFLKYADR
LYITEVDAEMTDLDAFFPQWDKSKYKRIGHKQFKKDDKNEFDFTFSVFEKNKNL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaatagatttctcaaaatgatctcactaatcgttgcttatgataaaaacttt
ggtataggtaaagaaaatactctagcatggaaactatcagaagatcttaagaactttaaa
aaaataacagaaaacaactatattgttatgggtagaaaaacctttgaatcgattggtcgc
ccactaccgaatcgtaaaaatattattttaactagagacaaagattacaaacaagataaa
tgtttaataataaatagtactcaggatattttaaattttgctgaatcaaaaccacactac
gaaatatttataatcggtggtgcacagatctataaagaatttctaaaatacgcagataga
ttgtatataaccgaagttgatgcagaaatgactgatcttgatgctttctttccacaatgg
gataaatcaaaatataaacgtattggtcacaaacaattcaaaaaagatgataaaaatgag
tttgactttacatttagcgtctttgaaaaaaataaaaatttgtaa

DBGET integrated database retrieval system