KEGG   Fusobacterium nucleatum subsp. animalis 4_8: HMPREF0409_00095Help
Entry
HMPREF0409_00095  CDS       T02680                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
fus  Fusobacterium nucleatum subsp. animalis 4_8
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fus00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0409_00095
   00330 Arginine and proline metabolism
    HMPREF0409_00095
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    HMPREF0409_00095
Enzymes [BR:fus01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     HMPREF0409_00095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1710309..1711223
Genome map
AA seq 304 aa AA seqDB search
MEELLKELVEKNRKFTADGNVANYIPELDKADKNALGIYVTTLDGQEFFAGDYNTKFTIQ
SISKIISLMLAILDNGEEYVFSKVGMEPSGDPFNSIRKLETSSRKKPYNPMINAGAIAVA
SMIKGKDDREKFLRLLDFAKLITEDDTLDLNYKIYIGESDTGFRNYSMAYFLKGEGIIEG
NVNEALTVYFKQCSIEGTAKTISTLGKFLANDGVLSNGERILTTRMAKIIKTLMVTCGMY
DSSGEFAVRVGIPSKSGVGGGICSVVPGKMGIGVYGPSLDKKGNSLAGGHLLADLSEELS
LNIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactattaaaggaattagttgaaaaaaacaggaaatttacagcagatggtaat
gttgctaattatattcctgaacttgataaagctgataaaaatgccctaggaatttatgtt
acaaccttagatggacaagaattttttgcaggagattataatacaaaatttacaatacaa
agtatttcaaaaataatttctttaatgttagcaatactagataatggtgaagaatatgtt
ttttcaaaggttggaatggaaccaagtggtgatccatttaactcaattagaaaacttgaa
acatcaagtagaaaaaaaccttataatcctatgataaatgcaggagcaatagctgttgct
tctatgataaaaggaaaagatgatagagaaaaatttttaagattattggattttgcaaaa
ttaataacagaagatgatactttggacttaaattataaaatttatattggagaatcagat
actggatttagaaactattctatggcatattttttaaaaggtgaaggtataattgaagga
aatgtaaatgaggcacttacagtgtattttaaacaatgctcaatagaaggaactgctaaa
actatttctacattaggaaaatttttagcaaatgatggtgtgctttcaaatggtgaaaga
attttaactacaaggatggcaaaaattattaagacattaatggtaacttgtggaatgtat
gatagttcaggagaatttgctgtaagagttggtatcccttcaaaaagtggagtaggtgga
ggaatttgttctgtcgttcctggcaaaatgggaataggtgtatatggtccttcacttgat
aaaaaaggaaactctcttgcaggagggcatttacttgcagatttatctgaagaactttct
ttaaatattttttaa

DBGET integrated database retrieval system