KEGG   Fusobacterium nucleatum subsp. animalis 4_8: HMPREF0409_00095Help
Entry
HMPREF0409_00095  CDS       T02680                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
fus  Fusobacterium nucleatum subsp. animalis 4_8
Pathway
fus00220  Arginine biosynthesis
fus00250  Alanine, aspartate and glutamate metabolism
fus00471  D-Glutamine and D-glutamate metabolism
fus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fus00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0409_00095
   00220 Arginine biosynthesis
    HMPREF0409_00095
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    HMPREF0409_00095
Enzymes [BR:fus01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     HMPREF0409_00095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AGM24080
UniProt: R9REH1
Position
1710309..1711223
Genome map
AA seq 304 aa AA seqDB search
MEELLKELVEKNRKFTADGNVANYIPELDKADKNALGIYVTTLDGQEFFAGDYNTKFTIQ
SISKIISLMLAILDNGEEYVFSKVGMEPSGDPFNSIRKLETSSRKKPYNPMINAGAIAVA
SMIKGKDDREKFLRLLDFAKLITEDDTLDLNYKIYIGESDTGFRNYSMAYFLKGEGIIEG
NVNEALTVYFKQCSIEGTAKTISTLGKFLANDGVLSNGERILTTRMAKIIKTLMVTCGMY
DSSGEFAVRVGIPSKSGVGGGICSVVPGKMGIGVYGPSLDKKGNSLAGGHLLADLSEELS
LNIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactattaaaggaattagttgaaaaaaacaggaaatttacagcagatggtaat
gttgctaattatattcctgaacttgataaagctgataaaaatgccctaggaatttatgtt
acaaccttagatggacaagaattttttgcaggagattataatacaaaatttacaatacaa
agtatttcaaaaataatttctttaatgttagcaatactagataatggtgaagaatatgtt
ttttcaaaggttggaatggaaccaagtggtgatccatttaactcaattagaaaacttgaa
acatcaagtagaaaaaaaccttataatcctatgataaatgcaggagcaatagctgttgct
tctatgataaaaggaaaagatgatagagaaaaatttttaagattattggattttgcaaaa
ttaataacagaagatgatactttggacttaaattataaaatttatattggagaatcagat
actggatttagaaactattctatggcatattttttaaaaggtgaaggtataattgaagga
aatgtaaatgaggcacttacagtgtattttaaacaatgctcaatagaaggaactgctaaa
actatttctacattaggaaaatttttagcaaatgatggtgtgctttcaaatggtgaaaga
attttaactacaaggatggcaaaaattattaagacattaatggtaacttgtggaatgtat
gatagttcaggagaatttgctgtaagagttggtatcccttcaaaaagtggagtaggtgga
ggaatttgttctgtcgttcctggcaaaatgggaataggtgtatatggtccttcacttgat
aaaaaaggaaactctcttgcaggagggcatttacttgcagatttatctgaagaactttct
ttaaatattttttaa

DBGET integrated database retrieval system