KEGG   Fusobacterium nucleatum subsp. animalis 4_8: HMPREF0409_02203Help
Entry
HMPREF0409_02203  CDS       T02680                                 

Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fus  Fusobacterium nucleatum subsp. animalis 4_8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:fus00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0409_02203
Enzymes [BR:fus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HMPREF0409_02203
Exosome [BR:fus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0409_02203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1191151..1192977)
Genome map
AA seq 608 aa AA seqDB search
MSGQVEQYLFHRGEYRQAYEYLGAHPTRNSTIFRIWAPAAKSVAVVGDFNDWTAREEDYC
RKLNNVGLWEVEIKKVKKGFLYKYQIETSWGEKILKSDPYAFYSELRPHTASIVNGIPKF
RWGDKKWLNNREIGYAKPINIYEIHLGSWKKKEDGTYYNYREIAELLVKYMLEMNYTHIE
IMPIIEYPFDGSWGYQGTGYYSVTSRYGMPEDFMYFVNYFHKNNLGVILDWVPGHFCKDS
HGLYRFDGSACYEYGDPSLGENEWGSANFNVTRNEVRSFLLSNLYFWVKEFHIDGIRMDA
VSNMLYYRDGLSENKHSVEFLQYINQSLHEEYPDVMLIAEDSSAWPLVTKYQADGGLGFD
FKWNMGWMNDTLKYMEQDPFFRKSHHGKLTFSFMYAFSENFILPLSHDEIVHGKNSILNK
MPGYYEDKLAHVRNLYSYQMAHPGKKLNFMGNEFVQGLEWRYYEQLEWQLLKDNKGSQDI
QKYVKALNKMYLEEEALWHDGQDGFEWIEHENINENMLIFLRKTPNMEDFIIAVFNFSGK
DHEKYPLGVPVEDGEYEVILDSNEKKFGGSYQGKKRKYKAIKKSWNYREQYIEIKIAKNS
TIFLKHKN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggacaagtggaacaatatttatttcatcgtggagaatataggcaagcctatgaa
tatctaggagcacacccaacacgaaattctactatatttagaatatgggcaccagctgca
aaatcagtagctgttgttggagattttaatgattggacagcaagagaggaagattattgc
cgaaaacttaataatgtaggtctttgggaagttgaaataaaaaaagttaaaaaaggtttt
ttatataagtatcaaatagaaacttcttggggagaaaagatattaaaatctgatccttat
gcattttattctgaacttagaccacatactgcttctattgtaaatggaataccaaaattt
cgttggggtgataaaaagtggcttaataatagagaaatagggtatgcaaaaccaattaat
atatatgaaattcaccttggctcttggaagaaaaaagaagatgggacttactataattat
agagaaattgcagaattgttagttaaatatatgttagagatgaactacactcatattgaa
attatgcctattattgaatatccatttgatggttcttggggatatcaaggtacaggatat
tattcagtaactagccgttatggaatgccagaagattttatgtattttgtaaattatttt
cataaaaataatttaggtgtaattttagattgggtaccaggacatttttgtaaagattca
catgggttatatcgttttgatggtagtgcttgttatgagtatggagatccaagtcttgga
gaaaatgaatggggtagtgcaaactttaatgttacaagaaatgaggtaagaagtttttta
ctttctaatttatacttttgggtaaaagaatttcatatagatggtataagaatggatgca
gtttctaatatgctttattatagagatggattgagtgaaaataaacattcagtagaattt
ttacaatatataaatcaaagtttacatgaagaatatccagatgttatgttgatagcagaa
gattcttctgcttggccattagtaactaaatatcaagcagatggtggacttggttttgat
tttaaatggaatatgggatggatgaatgacacattaaaatatatggagcaagatccattt
tttagaaaatcacatcatggaaaattaacattttcttttatgtatgctttttcagaaaat
tttatattaccattatcacatgatgaaatagttcatggaaaaaattctattttaaataaa
atgcctggttactatgaagataaattagctcatgtcagaaatttatattcttatcaaatg
gctcacccaggtaaaaaattaaattttatgggaaatgaatttgtacaagggcttgaatgg
agatattatgagcaattagaatggcaattattgaaggataataaaggttcacaagatata
caaaagtatgttaaagctctaaataaaatgtatttagaagaagaagctctttggcatgat
ggacaagatggttttgaatggatagaacatgaaaatataaatgaaaatatgctaattttt
ttaagaaaaactcctaatatggaagattttattatagcagtatttaatttttcaggaaaa
gaccatgaaaaatatcctcttggagttccagtggaagatggggaatatgaagttatttta
gacagtaatgaaaaaaaatttggaggctcttatcaaggaaagaaaagaaaatataaggca
ataaaaaaatcttggaattatagagaacagtacatagaaataaagattgctaaaaattca
actatatttttaaaacataaaaattaa

DBGET integrated database retrieval system