KEGG   Fragaria vesca (woodland strawberry): 101290762Help
Entry
101290762         CDS       T02666                                 

Definition
mitogen-activated protein kinase 4-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101290762
Protein kinases [BR:fve01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101290762
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101290762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 377 aa AA seqDB search
MAAKESSSAASAGDCKIKRVLTHNGRYAQYNVFGNLFEVSSKYVPPIRPIGRGAYGIVCA
AVNSDTHEEVAIKKIGNAFDNIIDAKRTLREIKLLRHMNHENVIGLKDIVRPPKKDTFND
VYIVYELMDTDLHQIIRSDQQLTDDHYQYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNA
NCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYSAAIDIWSVGCILGEIIT
REPLFPGKDYVHQLRLITELIGSPDDASLGFLRSDNTRRYVKQLPQIRRQQFSARFPNMS
PGALDLLEKMLVFDPTRRITVGEALCHPYLSSLHDNNDEPICPRPFHFDFEQPSCTEEHI
KELIWREAVKYNPEPTH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaggaatcaagctctgctgcttcagcaggagattgtaaaatcaaaagggtg
ctcacacataatggtagatatgcgcagtacaatgtgtttgggaacttgtttgaggtctct
agcaagtatgtcccgccaattaggccaattggtagaggtgcttatggcattgtttgtgct
gctgtgaattcagacacacatgaggaagttgccattaagaagatcggaaatgcttttgac
aacataatagatgccaagaggacgttaagagaaatcaagcttcttcgccatatgaaccat
gaaaatgttatcggcctcaaggacatcgtacgaccgcccaaaaaagacaccttcaatgat
gtatacattgtttatgagttaatggacactgatctacatcagatcattcgttctgaccaa
caactaacagatgatcattatcagtactttctgtatcagctgttaagaggactaaaatat
gttcactctgccaatgtgttgcaccgggatctgaagccaagtaatttgcttcttaatgct
aattgcgaccttaagatcggagattttggactagcaagaacaacatccgagacggatttc
atgaccgaatatgttgttactcgttggtaccgagcacctgagttgcttcttaattgttca
gagtacagtgctgcgattgatatatggtctgttggttgcatacttggtgaaatcataacc
agagaacctctttttcctgggaaggattatgttcatcagctgaggcttatcacagagcta
ataggttcacccgatgatgcaagtcttggatttcttcgaagtgataatacccgcagatat
gtaaaacagctcccacaaatccggaggcaacagttctctgctagattccctaatatgtcg
cctggagctctggatttgctagagaaaatgctcgtctttgatcccaccagacgcattact
gttggcgaggcactttgtcacccgtacttgtcgtcccttcacgacaacaatgatgaacct
atttgccccaggcctttccattttgattttgagcaaccatcatgcactgaagagcacatc
aaagagctcatctggagggaagcagtgaagtataatccagagccaactcactaa

DBGET integrated database retrieval system