KEGG   Fragaria vesca (woodland strawberry): 101290762Help
Entry
101290762         CDS       T02666                                 

Definition
(RefSeq) mitogen-activated protein kinase 4-like
Organism
fve  Fragaria vesca (woodland strawberry)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG5
AA seq 377 aa AA seqDB search
MAAKESSSAASAGDCKIKRVLTHNGRYAQYNVFGNLFEVSSKYVPPIRPIGRGAYGIVCA
AVNSDTHEEVAIKKIGNAFDNIIDAKRTLREIKLLRHMNHENVIGLKDIVRPPKKDTFND
VYIVYELMDTDLHQIIRSDQQLTDDHYQYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNA
NCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYSAAIDIWSVGCILGEIIT
REPLFPGKDYVHQLRLITELIGSPDDASLGFLRSDNTRRYVKQLPQIRRQQFSARFPNMS
PGALDLLEKMLVFDPTRRITVGEALCHPYLSSLHDNNDEPICPRPFHFDFEQPSCTEEHI
KELIWREAVKYNPEPTH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaggaatcaagctctgctgcttcagcaggagattgtaaaatcaaaagggtg
ctcacacataatggtagatatgcgcagtacaatgtgtttgggaacttgtttgaggtctct
agcaagtatgtcccgccaattaggccaattggtagaggtgcttatggcattgtttgtgct
gctgtgaattcagacacacatgaggaagttgccattaagaagatcggaaatgcttttgac
aacataatagatgccaagaggacgttaagagaaatcaagcttcttcgccatatgaaccat
gaaaatgttatcggcctcaaggacatcgtacgaccgcccaaaaaagacaccttcaatgat
gtatacattgtttatgagttaatggacactgatctacatcagatcattcgttctgaccaa
caactaacagatgatcattatcagtactttctgtatcagctgttaagaggactaaaatat
gttcactctgccaatgtgttgcaccgggatctgaagccaagtaatttgcttcttaatgct
aattgcgaccttaagatcggagattttggactagcaagaacaacatccgagacggatttc
atgaccgaatatgttgttactcgttggtaccgagcacctgagttgcttcttaattgttca
gagtacagtgctgcgattgatatatggtctgttggttgcatacttggtgaaatcataacc
agagaacctctttttcctgggaaggattatgttcatcagctgaggcttatcacagagcta
ataggttcacccgatgatgcaagtcttggatttcttcgaagtgataatacccgcagatat
gtaaaacagctcccacaaatccggaggcaacagttctctgctagattccctaatatgtcg
cctggagctctggatttgctagagaaaatgctcgtctttgatcccaccagacgcattact
gttggcgaggcactttgtcacccgtacttgtcgtcccttcacgacaacaatgatgaacct
atttgccccaggcctttccattttgattttgagcaaccatcatgcactgaagagcacatc
aaagagctcatctggagggaagcagtgaagtataatccagagccaactcactaa

DBGET integrated database retrieval system