KEGG   Fragaria vesca (woodland strawberry): 101292100Help
Entry
101292100         CDS       T02666                                 

Definition
protein disulfide isomerase-like 1-4-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101292100
Enzymes [BR:fve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101292100
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101292100
  Exosomal proteins of colorectal cancer cells
   101292100
  Exosomal proteins of bladder cancer cells
   101292100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 566 aa AA seqDB search
MASRLVLLFTFTALLIHLSSRPALSVDDDDEDLSFLEEPTEQGHHAPHYPDPDQFDADSY
DEADDFSDFDEGDQDAFKEPEVDEKDVVVLKGANFSETIKKNRFVLVEFYAPWCGHCQAL
APEYAAAATELKGGDVILAKVDATEENELSQEYDVQGFPTLFFFSDGVHKPYTGQRTKEA
IVTWIKKKTGPGIANVTTVEDAERILTSETKFVVGFLNSLVGPESDELSAASRLDDDVNF
YQTVDPKVAKLFHIDSDVKRPALVLIKKEDEKLSHFDGKFDKSAIAEFVFANKLPLVVTF
TRENAPSIFESEIKKQLLLFATSKDSKKVLPEFVEAAKLFKGKLIFVFVETDNEDVGKPV
SEYFGITGDAPTVLAYTGNDDARKFILDKEVTLANIKAFGEDFLEDKLKAFYKSDPIPET
NDGDVKIVVGNNFDDIVLDESKDVLLEIYAPWCGHCQSLEPTYNKLAKHLRGIESIVIAK
MDGTTNEHPRAKADGFPTLLFFPAGNKSFDPITVDSDRTVVAFYKFLKKHTSIPFKLQKP
TSTPKSKEYVAKESQESSTNDVKDEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtcgactcgttctcctgttcacattcaccgccctcctcatccacctttcctcc
cgccccgccctctccgtcgatgacgacgacgaggatctcagcttcctcgaagagccgacc
gagcagggccaccacgcgccgcactatccagatccggaccaattcgacgccgacagctac
gacgaagccgacgacttctccgatttcgacgagggcgatcaggacgcgtttaaggagccg
gaggtcgacgagaaggacgtcgtcgttttgaaaggggcgaacttcagcgagacgatcaag
aagaacaggttcgtgttggttgagttctatgcgccgtggtgcggtcactgccaggccttg
gctccggaatacgcggcggccgcgacggagctcaagggcggagatgtaattttggccaaa
gttgatgcgacggaggagaatgagttgtcgcaggagtatgatgtgcagggttttccgact
ctctttttctttagtgatggagttcacaagccttatacaggtcaaaggaccaaagaggct
attgtgacctggatcaagaagaagaccgggcctggtatcgctaacgtgaccacggtggag
gatgcagagcgcattttgacttctgaaactaaatttgttgtgggattcctcaactctttg
gtgggtcctgagagtgatgagctttctgctgcttcaagacttgacgatgatgtcaacttc
taccaaacagtggatccaaaggtggcaaaactattccatattgactccgacgtcaaacgc
cctgcactggtcctgataaagaaagaggatgagaagctaagccatttcgacggtaaattt
gacaagtctgcaattgccgagtttgtctttgcaaacaagcttcctttggttgtcacgttt
actagggagaatgcaccttccatttttgaaagtgaaataaagaaacagctgttgctcttc
gccacttcgaaggactcaaagaaggttctcccggagtttgtagaggcagcaaaattattc
aaaggaaagcttatctttgtatttgtggaaacggataatgaagatgtcggaaagccagtt
tcagaatattttggcatcactggtgatgctccaacggttctcgcatacaccggaaatgac
gatgctaggaagtttattcttgacaaagaagtgaccttggctaacataaaggcttttggg
gaggacttccttgaggataaactaaaagctttctataagtcagacccgatcccggaaact
aacgatggagatgtgaaaatagttgttggaaataactttgatgatattgtcttggatgag
tcaaaggatgttcttcttgagatttatgcaccctggtgtgggcattgccaatctctggaa
ccaacctacaacaagcttgccaaacatcttcgaggcattgaatctattgttatagccaag
atggacggaaccactaatgagcatcccagggcaaaggctgatgggttccccacacttcta
ttcttcccagctggaaataagagctttgatccgattacagtagattctgaccgtacagtg
gtggcattctacaagttcctcaagaaacacacatcaatccctttcaagctccaaaagccg
acttcaactccaaaatccaaggaatatgttgctaaagagagccaggagagcagcaccaat
gacgtgaaggatgaattgtga

DBGET integrated database retrieval system