KEGG   Fragaria vesca (woodland strawberry): 101292222Help
Entry
101292222         CDS       T02666                                 

Definition
probable protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101292222
Enzymes [BR:fve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101292222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 362 aa AA seqDB search
MSSNKTLFAIGALALLFVSSVFADDVVVLTDDNFEKEVGQDRPALVEFYAPWCGHCKKLA
PEYEKLGASFKKAKSVLIAKVDCDEHKSVCGKFGVSGYPTIQWFPKGSLEPKKYEGARTS
EALVEYVNKEAGTNVKIAAIPSSVVVLTQDNFDEVVLDKTKDVLVEFYAPWCGHCKSLAP
TYEKVAAAFKLDGDVVIANLDADKYKDIAEKYGVSGYPTLKFFPKGNKDGEEYGGGRDLE
DFVNFINEKCGTSRDAKGQLTSKAGIVASLEELVKEFVKASGEEKKAIVSKIEEEVGKLE
GSSARYGKIYLNAAKKSLAKGGDYAKNEIQRLERILEKSVNPTKADEFTLKKNVLYTFSS
SS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaaacaagactctgttcgcaatcggagccctagctctgctcttcgtctcatcg
gttttcgcagacgacgtcgtcgtgctgaccgacgacaacttcgagaaggaggtcggtcaa
gatcgccctgctctcgtcgagttctacgctccctggtgtgggcattgtaagaagcttgct
ccggagtatgagaagctaggcgcaagtttcaagaaagcaaagtctgttttgatcgcaaag
gtggactgtgatgagcacaagagtgtctgtggcaagtttggagtttccggttaccccaca
attcagtggttcccgaaaggatcattagaacccaaaaagtatgaaggtgcccgtacttca
gaagctcttgttgagtatgtgaataaggaagcagggaccaatgtgaaaatagctgcaatt
ccatccagtgttgtggtacttacacaggataattttgatgaggttgtcttggacaaaaca
aaagatgtactggtggagttttatgcaccatggtgcggacactgcaaatcccttgctcct
acttatgagaaggttgcagcagcatttaagttggatggagatgtagtgatcgctaacctt
gatgctgacaaatacaaggatatcgctgagaagtatggagtgagtggatatcctacattg
aaatttttcccaaagggcaacaaggatggtgaagagtatggtggaggcagagatttggaa
gattttgtaaatttcatcaatgagaaatgtggcactagcagagatgcgaaagggcaactt
acttccaaagctggtatagtcgcaagtttggaagagttagtgaaggaatttgtgaaagct
agcggtgaggagaagaaagcaattgtttccaaaatcgaagaggaagttggaaagcttgag
ggttcttctgcaagatacggtaagatctacttgaatgctgccaagaagtctttggcaaaa
ggtggtgactatgcaaagaacgaaattcagcgtcttgaacgcattctcgaaaagtctgtc
aacccaacaaaggccgatgagttcactctcaagaagaacgttctatacaccttttcttca
tcttcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system