KEGG   Fragaria vesca (woodland strawberry): 101292902Help
Entry
101292902         CDS       T02666                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
fve  Fragaria vesca (woodland strawberry)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 233 aa AA seqDB search
MASSYRTQSAKRWLPLEANPDVMNQFLWGLGLQEDDAECYDVYGLDGELLEMVPKPVLAV
LFLYPLNPKTEEERMMQLNENQETKGNVYFMKQTVGNACGTIGLLHAVGNITSEIKLVDG
SYLDRFFRSTASMDPLQRAAFLENDNEMEVAHSVAATAGDTEASDDVDTHFICYACVDGE
LYELDGRKSGPISHGPSSPNTLLQDAAKVIQGVIQKNPESLNFNVIAISKKSG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcgtacagaacccagtccgctaagagatggcttcctcttgaagctaatccc
gatgttatgaaccagttcctttggggactgggccttcaagaggatgacgcagaatgctat
gacgtttatgggttggatggagaactcttagaaatggttccaaagcctgtacttgctgtg
ctgtttctttatcctttaaaccctaagactgaagaagagagaatgatgcagttaaatgaa
aaccaggaaaccaaaggtaatgtttattttatgaaacaaaccgtgggcaatgcttgtgga
actattggactccttcatgctgttggaaacatcacttcagagatcaaacttgttgatggg
tcatacttggatagatttttcagaagtactgcaagcatggatccattgcagcgtgcagca
ttccttgagaatgacaatgaaatggaagttgctcattcagtagcagctactgctggtgac
acagaggcttcagatgatgttgacactcactttatctgctatgcatgtgtggatggggaa
ctatatgagcttgatgggaggaagtctggtccaatctctcacggcccgtcttcaccaaac
actctattacaggatgcagctaaagtcatacaaggggtgatccagaaaaatcccgagtct
ctcaacttcaacgtcattgccatttcgaagaaatccgggtga

DBGET integrated database retrieval system