KEGG   Fragaria vesca (woodland strawberry): 101292902Help
Entry
101292902         CDS       T02666                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101292902
Peptidases [BR:fve01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101292902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 233 aa AA seqDB search
MASSYRTQSAKRWLPLEANPDVMNQFLWGLGLQEDDAECYDVYGLDGELLEMVPKPVLAV
LFLYPLNPKTEEERMMQLNENQETKGNVYFMKQTVGNACGTIGLLHAVGNITSEIKLVDG
SYLDRFFRSTASMDPLQRAAFLENDNEMEVAHSVAATAGDTEASDDVDTHFICYACVDGE
LYELDGRKSGPISHGPSSPNTLLQDAAKVIQGVIQKNPESLNFNVIAISKKSG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcgtacagaacccagtccgctaagagatggcttcctcttgaagctaatccc
gatgttatgaaccagttcctttggggactgggccttcaagaggatgacgcagaatgctat
gacgtttatgggttggatggagaactcttagaaatggttccaaagcctgtacttgctgtg
ctgtttctttatcctttaaaccctaagactgaagaagagagaatgatgcagttaaatgaa
aaccaggaaaccaaaggtaatgtttattttatgaaacaaaccgtgggcaatgcttgtgga
actattggactccttcatgctgttggaaacatcacttcagagatcaaacttgttgatggg
tcatacttggatagatttttcagaagtactgcaagcatggatccattgcagcgtgcagca
ttccttgagaatgacaatgaaatggaagttgctcattcagtagcagctactgctggtgac
acagaggcttcagatgatgttgacactcactttatctgctatgcatgtgtggatggggaa
ctatatgagcttgatgggaggaagtctggtccaatctctcacggcccgtcttcaccaaac
actctattacaggatgcagctaaagtcatacaaggggtgatccagaaaaatcccgagtct
ctcaacttcaacgtcattgccatttcgaagaaatccgggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system