KEGG   Fragaria vesca (woodland strawberry): 101292919Help
Entry
101292919         CDS       T02666                                 

Definition
1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101292919
Enzymes [BR:fve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101292919
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101292919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 830 aa AA seqDB search
MAFMLGVIPNMCLIRGKIFAGKSSYDSDSASSLTVAASKKILVPGGPSDGSPPLTEELEA
PDTDSEDPQVLEDVDSVTMEDEKIEDEAISSLDVGSVDDETPSPLKATASTATKTIPPPG
TGQKIYEIDPLLKGFRDHLDYRYGQYKRLREEIDKYEGGLEVFSRGYEKFGFTRSATGIT
YREWAPGAKSASLIGDFNNWNMNADVMTRNEFGVWEIFLPNNADGSPAIPHGSRVKIRMD
TPSGIKDSIPAWIKFSVQAPNEIPYNGIYYDPPEEEKYVFQHPQPNRPQSLRIYEAHVGM
SSTEPKINSYAEFRDDVLPRIKKLGYNAVQLMAIQEHAYYASFGYHVTNFFAPSSRCGTP
DDLKSLIDRAHELGLLVLMDIVHSHASNNTLDGLNMFDGTDSHYFHSGPRGYHWMWDSRL
FNYGSWEVLRYLLSNARWWLEEFKFDGFRFDGVTSMMYTHHGLQVAFTGNYSEYFGLATD
VDAVTYLMLVNDLIHGLYPEAISIGEDVSGMPAFCIPVADGGVGFDYRLHMAIADKWIEL
LQKMDEYWQMGDIVHTLTNRRWGEKCVAYAESHDQALVGDKTIAFWLMDKDMYDFMALDR
PSTPTIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFPRGVQKLPNGKIVPGN
NNSFDKCRRRFDLADADYLRYHGLQEFDRAMHHLEETYSLGCSITKFNQLLIQFMTSEHQ
YISRKDEGDKVIVFERGNLVFVFNFHWSKSYSDYRVGCLKPGKYKIVLDSDESIFGGFNR
IDHTADYFTVDGWYDERPNSFQLYAPCRTAVVYALVESKETSKEKKPIKG
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggcctttatgttgggggttattccgaacatgtgcttaattcgcgggaagatctttgcc
ggaaagtcttcatatgattctgattcagcttcttctttaactgttgctgcttcaaagaaa
attcttgttcctggaggtccgagtgatggctctccacctttgacagaggaattggaagct
cccgacactgattcagaggatcctcaggtgctagaggatgtagacagtgtaactatggaa
gatgagaagattgaagatgaagcaatttcttcgttagatgtgggcagtgttgatgatgaa
acacctagtcccttaaaagcaacagcaagtactgctacaaagacaattccaccacctggc
actgggcaaaaaatatatgaaatagatccacttttgaagggcttccgggatcatctcgat
taccgttatggacaatacaaaaggctgcgtgaggaaattgacaagtatgaaggtggtttg
gaggtgttttctcgtggctatgagaagtttgggttcacacgcagtgccacaggtatcact
tatagggagtgggcacctggagctaagtccgcatcattaattggagatttcaacaattgg
aatatgaatgcggatgtgatgactcggaatgaatttggggtctgggagatctttttgcca
aacaatgcagatggttcacccgcaattccacatggttctcgagtgaagatccgtatggat
accccttcaggtatcaaagactcaattcctgcttggatcaagttttcggtacaggctcct
aatgaaatcccatacaatggaatatactatgatcctccagaagaggagaagtatgtattt
caacatcctcagccaaatagaccacaatcactccgcatttacgaggcacatgttggaatg
agtagcacagagccaaaaattaactcgtatgctgaattcagagatgatgtgctaccacgc
attaaaaagcttgggtacaatgctgttcagctcatggctattcaggagcatgcctactat
gcaagctttgggtaccatgtcaccaatttttttgcgcctagcagccgatgtggaacacct
gacgatctgaaatctctgatagatagggctcatgaacttggtctgcttgtactcatggat
attgttcacagccatgcatcaaataatacgttggatgggctgaacatgtttgatggaacc
gatagtcactacttccactctgggccccgtggatatcattggatgtgggattctcgcctt
ttcaattatggaagttgggaggttttgaggtatcttctctcaaatgcaaggtggtggttg
gaagaatttaagtttgacgggttcagatttgatggtgtaacttcaatgatgtatactcac
catggattgcaggtagcatttactggaaactacagcgagtattttggattagcaacagat
gtagatgctgttacttacctgatgctggttaatgatttgattcacgggctctaccccgaa
gctattagcatcggtgaagatgttagtggaatgccagcattttgtattcctgttgcagat
ggcggtgttggatttgattatcgcctgcatatggctattgctgataaatggattgagctc
ctccaaaaaatggatgagtactggcaaatgggtgatattgttcacacgctgaccaacaga
agatggggagagaagtgtgttgcttatgcggaaagtcatgaccaagctcttgttggtgac
aaaacaattgcattctggttgatggacaaggatatgtatgatttcatggctctggataga
ccatcaactcccactatagaccgtggaattgcattacacaaaatgattaggcttattact
atgggattaggtggagaaggatatctgaattttatggggaatgaatttggacatcctgag
tggattgattttccaagaggtgttcaaaaacttccaaatggaaaaatagttcctgggaac
aacaacagttttgacaaatgccggcgtagatttgatcttgcagatgctgactatctgaga
tatcatggcttgcaagaatttgatcgagcaatgcatcatcttgaagaaacttatagtctg
ggctgttctattactaaatttaatcaactcttgatccagttcatgacttctgagcaccaa
tatatatctcgaaaggatgaaggagataaagttatcgtctttgaaaggggaaacctggtt
tttgtgttcaattttcattggagtaaaagctattcagactaccgagtaggctgcttaaag
ccaggaaagtataagattgtcttggattcagatgagtcaatatttggaggcttcaatagg
attgatcacaccgctgattacttcactgttgacggatggtatgatgagcggcccaattcc
ttccaactatatgcaccttgtagaacagctgtggtgtatgctctagtagagagcaaggaa
acgagcaaggaaaagaaacccatcaaaggctga

DBGET integrated database retrieval system