KEGG   Fragaria vesca (woodland strawberry): 101293017Help
Entry
101293017         CDS       T02666                                 

Definition
protein disulfide isomerase-like 1-6-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101293017
Enzymes [BR:fve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101293017
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101293017
  Exosomal proteins of colorectal cancer cells
   101293017
  Exosomal proteins of bladder cancer cells
   101293017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 531 aa AA seqDB search
MFRPKPTSRFILLALTLLLLANFIASITATTESEDSELEELLALDDEVEQEEEQGGVSNV
RSSEAEVLTKAQRIVLELNHDNTKRVIEKNEFVLVLGYAPWCARSAELMPQFAEAATSLS
ELGSPLLMAKLDGERYPKTASLLEIKGFPTLLLFVNGTSQVYTGGFSAEEIVIWARKKTG
EPVIRISSVPAAKEFLKRHNIFVVGLFEKFEGPHYKEFVKAATADNAIQFVEVSNIDVAN
VLFPNVKQVNLFLGIVKSEAERYTAYDGTFEMEQILKFLDYNKFPLVNRLTESNSATVYS
SPLKLQVIVFAEEDEFKKLLEPLQDVARQFKSEIMFIYIDITDENLAKPYLTLFGLEEAE
STVVVAFDVRVNSKYLLESNPTPSNIKEFCSGLLHGTLSPYFKSQPIPNNTNETVHVAVG
KTFDDLVLNNNKNVLLEVFTPWCITCETTSKQVEKLAKHFKSLDNLFFAKIDASVNEHPK
LKVNDYPTLLFYTANDKEDPIKLSTKTSLKDLATSINKHVKAKYEVAKDEL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaccaaaacccacatcaagattcatccttttagccctcacccttctcctacta
gccaacttcatagcttcaatcacagccactactgaaagtgaagacagtgaattggaggag
ctactagcattggatgatgaagtggaacaagaagaagagcaaggaggggtttcaaatgtg
aggtcttcagaggcagaggtgttaaccaaagcccaaaggattgttcttgagctcaaccat
gacaataccaagagggtgattgagaagaatgagtttgttctggttcttgggtatgctcct
tggtgtgccagaagtgctgagctcatgcctcaatttgctgaggccgcaacttcactcagt
gaattggggagtccccttctgatggctaagcttgatggagagaggtatccgaaaacggcg
tcgttgcttgagatcaaagggttccctactctgcttctgtttgtcaatggcacgtctcaa
gtgtacactggtggattttctgcggaagaaatagtgatatgggcaaggaagaagaccggt
gagcctgttattaggataagctcagtgccagctgcaaaggagtttctcaagaggcacaat
atatttgttgttggtttgtttgaaaagtttgaggggcctcactataaagaatttgtaaaa
gcagcaactgctgataatgcaatccagttcgtagaagtaagcaacattgatgttgccaat
gttctctttcccaatgtaaaacaagttaatcttttccttggaattgtgaaaagtgaggct
gaaagatacactgcatatgatgggacatttgagatggagcaaatattgaagttcttggac
tataacaagtttccattagttaacagactgactgaatcaaattctgccacagtttactcc
agccctcttaaacttcaggtcattgtctttgcagaagaagatgaattcaagaaacttctg
gagcctcttcaggatgttgctcgacagttcaagtcagagataatgtttatttatatagac
atcacagatgaaaaccttgccaagccttacttaacattatttgggctagaagaagcagag
agcactgtggtggttgcttttgatgtcagagtcaactctaaatatctattagaatcaaat
ccaacaccaagcaatataaaggagttctgctcggggcttttgcatggcactctgtctcca
tacttcaaatcacaaccaatacctaataacacaaatgaaacagtccatgtcgccgttgga
aagacatttgatgacttggttttgaataacaacaagaatgttctactagaggtgttcaca
ccctggtgcatcacatgtgagaccactagcaagcaagttgagaagttggctaagcatttc
aaaagcttggataatttattcttcgcaaaaattgatgcttctgtaaatgaacatccaaaa
ctgaaagtaaatgactatccaacactcttattttacacagccaatgataaagaggatccg
atcaaactttctacaaaaaccagcttgaaggacctggcgacatcaatcaacaaacatgtg
aaagccaaatacgaagttgctaaagatgaactatag

DBGET integrated database retrieval system