KEGG   Fragaria vesca (woodland strawberry): 101293459Help
Entry
101293459         CDS       T02666                                 

Definition
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    101293459
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     101293459
    1.1.1.234  flavanone 4-reductase
     101293459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 349 aa AA seqDB search
MGSESESVCVTGASGFVGSWLVMRLLERGYTVRATVRDPTNAKKVKHLLDLPKAATHLTL
WKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTINGVLDIMKACLKAKTV
RRLVFTASAGSVNVEETQKPVYNESNWSDVEFCRRVKMTGWMYFVSKTLAEQEAWKFAKE
NNIDFITIIPTLVIGPFLMPAMPPSLITGLSPLFGNEGHYSIIKQGQFVHLDDLCQSHIY
LYEHPKAEGRYICSSHDATIHEIGKLLREKYPEYNVPTKFKGIEDNLTKVHFSSKKLLET
GFEFKYSLEDMFVGAVDACKAKGLLPPPTERVEKQENGDSSVVHVEVTG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggatcggagtccgaatccgtttgtgtcaccggagcctccggtttcgtcggatcatgg
ctggtcatgagactcctagagcgtggctacactgtccgagccaccgtgcgagaccctact
aatgcgaagaaggtgaagcatctgctagacttgccgaaggcggcgactcacttgacgctg
tggaaggcggacctggcggacgagggcagcttcgacgaagccattaagggatgcaccggt
gtgttccatgtcgccacacctatggattttgagtccaaggaccctgagaatgaagtgata
aagccaacaataaacggggtgttagacatcatgaaagcatgtctgaaagcaaagactgtg
agaaggttggtgtttacagcttctgctggatctgtaaatgttgaagagacccaaaagccg
gtctacaacgaaagcaactggagcgatgtcgaattttgccggagagtaaagatgactggt
tggatgtattttgtatcaaaaactctggctgagcaagaggcatggaagtttgcaaaagaa
aacaacattgatttcattaccattataccaactctggtcatcggtccatttctcatgccg
gctatgccgccgagtctcattaccggactttcgcctctatttggaaatgaaggtcattat
tcgatcataaagcaaggccagtttgtgcatctagacgacctctgccagtctcatatatac
ttgtacgagcatccgaaagcagagggtcgctacatttgttcatcgcacgatgctacgatt
catgaaattggaaaattgctaagagaaaagtatccggaatacaatgttcctacaaagttc
aagggcattgaagataacttgacaaaggtccatttttcttcaaagaaattgttggaaaca
gggtttgagttcaagtacagcttggaggacatgtttgtaggggcagtcgatgcttgtaaa
gcaaagggtttgcttccacctcctactgaaagagttgagaagcaggagaatggcgatagc
agtgtcgtccatgtcgaagtcactggctaa

DBGET integrated database retrieval system