KEGG   Fragaria vesca (woodland strawberry): 101294219Help
Entry
101294219         CDS       T02666                                 

Definition
(RefSeq) palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like
  KO
K20416  
palmitoyl-[glycerolipid] 7-desaturase [EC:1.14.19.42]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.42  palmitoyl-[glycerolipid] 7-desaturase
     101294219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG1
AA seq 202 aa AA seqDB search
MARLLWVVQKPVYFLGRQWNGVDIASVITLSVVHLIALLAPFYFTWSAFWLGVALYFVTG
VGITLSFHRNLAHKSFKLPKWLEYFFAYCAVHSLQGSPLEWVSSHRSHHQFTDTPSDPHT
PLKGFWFSHIGWIFDFRKRFGSYDGKLYNVGDLKKQSFYKFLHYTYPYHCIACGVVLYLI
GGMPYLVWALVIKLLLYTFANI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggctactttgggtggtgcagaagcctgtatattttctggggagacaatggaat
ggcgtcgacatcgctagtgtcatcaccctttctgttgttcatctcattgctcttctcgca
ccattttacttcacctggtctgcgttttggttgggtgtagccctttactttgtcaccggt
gtgggaataactctatctttccatagaaatctcgcccacaaaagcttcaagcttcccaaa
tggctggaatacttcttcgcctattgtgccgttcattcacttcagggaagtccattagaa
tgggttagctcgcacaggagtcatcaccagtttacagacacgccgagtgaccctcatact
cctcttaagggtttctggtttagtcatattggctggatttttgattttcgtaaacgtttt
gggagttatgatggaaaactatacaatgttggagatttgaagaaacaaagcttctataag
tttcttcattacacttacccttatcactgtattgcttgtggagttgtgctctatctcata
ggaggaatgccttatttagtttgggcactggtaattaaacttctcttatatacatttgct
aatatctaa

DBGET integrated database retrieval system