KEGG   Fragaria vesca (woodland strawberry): 101295116Help
Entry
101295116         CDS       T02666                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101295116
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101295116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 377 aa AA seqDB search
MSSMRAIASSPSQQWDSKLQTHLPNASNKPINTNPNLQFKPTRHPLPCFSLNSSKSQTPL
TPISPTTPPLVVVGSANADIYVEIERLPKKGETISAKTGQTLAGGKGANQAACGGKLAYP
TYFVGQVGEDAHGKLVTEALRGGGVHLDHLSSVGGAPTGHAVVMLQGDGQNSIIIVGGAN
MSCWPERLSDEDLRVVRSAGIVLLQREVPEEVNIQVAKAAKSAGVPVILDAGGMDAPISQ
ELLNYVDIFSPNETELGRLTGMPTESFEHISKAVAKCHKMGVRQVLVKLGHKGSALFVEG
EEPLKQPIISAAKVLDTTGAGDTFTASFAVALVEGKSKKECLRFAAAAASLCVQVKGAIP
SMPERKSVLKLLQSLSG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgatgagagcaatagcatcttcaccatcccaacaatgggactccaaactccaa
acccatctcccaaacgcatcaaacaaaccaatcaacaccaacccaaatctccaatttaaa
cccacaagacacccacttccctgcttctccctaaactcctcaaaatcccagaccccactg
accccaatcagccccacaaccccaccacttgtggtggtgggctcagccaatgcagacatc
tatgtagagattgagaggctccccaagaagggtgagaccatctcagccaaaactggccag
accctggctgggggcaaaggagccaaccaggctgcctgtggtggcaagctggcttaccca
acttactttgtgggccaggtgggtgaggatgcccatgggaaacttgtcaccgaggccctt
agaggtggtggggttcatttagatcacctgagtagtgtgggtggggcacccactgggcat
gctgtggtcatgttgcagggtgatgggcagaactctattatcattgtgggtggtgccaac
atgagctgttggcctgagaggctgagtgatgaggatttaagggttgtgaggagtgctggg
attgttttgcttcagagggaggttccggaagaggtcaacattcaggttgccaaggctgcc
aagagtgcaggtgtaccagtcattttggatgctggaggaatggatgcaccaatctcccag
gagctattgaactatgttgatatttttagcccaaatgaaactgagcttggtcgtttgaca
ggaatgccaaccgaaagctttgaacatattagtaaggctgtggccaaatgccataaaatg
ggtgttaggcaagtcctggtaaaacttgggcacaaaggatctgctctatttgtagaaggc
gaagaaccacttaaacaacctatcatatctgctgcgaaagtacttgatactactggagct
ggtgatacatttacagcctcttttgcggttgctcttgtggagggcaagtccaaaaaggaa
tgcctgagatttgcagctgcagctgcttctctttgtgttcaggtgaagggagccattcct
agcatgcccgagaggaaatcagttttgaagcttcttcaatctctttcaggatag

  All links  
No link information was found.   
DBGET integrated database retrieval system