KEGG   Fragaria vesca (woodland strawberry): 101295183Help
Entry
101295183         CDS       T02666                                 

Definition
histone acetyltransferase GCN5-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
Enzymes [BR:fve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101295183
Transcription machinery [BR:fve03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101295183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 548 aa AA seqDB search
MDTHSSHLAVSNRSRSSQSPSPSHSASASATSSIHKRKLASEDHAPPFPPSSFSADTRDG
ALTSNDDLESISARCGGADSDSDDESEALGDDDEDFDHDSSMRNFTAARLDNSGGSAAAS
ARNSKLKTENLTVKIENSDGGVKDGGGNAGTGAVGPTSSVPGIMVKEDATKIFTENIQTS
GAYSAREELLKREEEAGRLKFATLSNDGVDEHMIWLVGLKNIFARQLPNMPKEYIVRLVM
DRSHKSVMVIRRNHVVGGITYRPYVSQRFGEIAFCAITADEQVKGYGTRLMNHLKQHARD
VDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWHGYIKDYDGGILMECKIDPKLPYTD
LSTMIRRQRQAIDEKIRELSNCHIVYPGIDFQKKEAGIPKKLIKVEDIPGLREAGWTPDQ
WGHSRFGALTASTENAKKHLTAFMRALLKSMHDHVDAWPFKEPVDARDVPDYYDIIKDPM
DLKTMSKRVESEQYYVTFEMFVADAKRMFANACTYNSPDTIYYKCARRLASHFESKVQSG
LQAGAKIQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggacacgcactcttctcacctcgccgtgtccaaccgttcccggagctcacagtcccct
tcgccgtcccactcggcctccgcctccgccacctcctccatccacaagcgcaagctcgcg
tctgaggaccacgcgcctcccttccctccctcctccttctccgcagacactcgcgacggc
gccctcacctccaacgacgacctcgagagcatctccgcccgctgcggcggcgccgactcc
gactccgacgatgagtccgaggccctgggcgacgacgacgaggacttcgaccacgactcc
tccatgcgaaacttcaccgcggcgcgcctcgacaacagcggcggttccgccgcggcctcg
gcgcgcaattcgaagctcaagacggagaatttgaccgttaagattgagaattcggatggt
ggagttaaggacggcggcgggaatgccgggaccggcgcggtggggcctacttcgtcggtg
ccgggaataatggtgaaggaggacgcaactaaaatattcacagagaatatacaaaccagt
ggagcttatagcgctagagaagagctattgaaaagagaggaggaagcggggaggctcaag
tttgcaacgctttcgaatgatggtgtagatgagcatatgatctggttggtaggattgaag
aacatatttgccaggcaactaccaaacatgcccaaggagtacattgttcgactggttatg
gataggagccataagtcggttatggttatcagacgtaatcatgttgttggtggcataact
tatcgaccatatgtcagccaaaggttcggagagatagctttttgcgcaatcacagctgat
gaacaagtaaaaggttatggcaccagacttatgaatcacttaaaacagcatgcacgggat
gttgatgggctaacccatttcctgacatatgctgacaataatgctgttggctattttatt
aaacagggttttacgaaagagatctacttggagaaggacagatggcatggctatataaag
gattatgatggaggaatcctaatggaatgcaaaatagacccaaaacttccatatactgat
ttatcaactatgattcgtcgtcaaaggcaggcaattgatgaaaagataagagagctctca
aattgtcatattgtttatcctggcattgatttccaaaagaaagaagctggtattcctaaa
aagctcatcaaggtcgaggacatccctggcttaagggaggccgggtggacccctgatcaa
tggggccattcacgttttggagcattgacagcttccacagagaatgccaaaaagcatttg
actgctttcatgcgtgcacttctaaagtctatgcatgaccatgttgatgcgtggccattc
aaggaaccagtcgatgcacgtgatgttcctgattattatgacattatcaaagatcctatg
gatctaaagacaatgtcaaagagggtagagtcagagcagtattatgtaacatttgagatg
tttgttgcggatgccaagaggatgttcgcaaatgcatgcacttataattctcctgatact
atttattacaagtgtgcaagaaggctggcatctcactttgaaagcaaagtgcaatcaggt
ctccaagctggtgccaaaatacagtag

DBGET integrated database retrieval system