KEGG   Fragaria vesca (woodland strawberry): 101295242Help
Entry
101295242         CDS       T02666                                 

Definition
steroid 5-alpha-reductase DET2-like
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    101295242
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101295242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 262 aa AA seqDB search
MATSSDQIFFNNCLLCLYLIGPPTFISLRFLQAPYGKHNRPGWGPTISPPLAWFLMESPT
LWLTLLLFPYGQHSTNPQALILITLFLLHYINRACLYPLRLYRNTIRKTAPGFPVSVALM
AFVFNLLNAYLQSRWVSHYKDYEGDHHGLFWLRFCVGLVVFLGGMSVNVWSDRVLVGLKK
EGGGYKIPRGGWFELVSCPNYFGEIVEWVGWAVMAWSWAGLGFLLYTCANLVPRARANHR
WYLEKFGEDYPKSRKAVIPFLY
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcgtcagatcagatcttcttcaacaactgcctcctctgcctctacctcata
ggccctcccaccttcatctccctcagattcctccaagccccctacggcaagcacaaccgg
ccagggtggggccccaccatctctccgccgttggcttggttcctcatggaatcaccaacc
ctgtggctcactctactcctcttcccctacggccaacacagcaccaacccccaagcctta
attctaataaccctctttctcttgcactatatcaaccgagcctgcctctacccacttcgc
ctctaccggaataccatccggaaaaccgcccccggttttccggtcagcgtggcgttgatg
gcatttgtgttcaatttattgaatgcttacttgcagtccagatgggtgtctcactacaag
gactatgagggtgatcatcatgggttgttttggctgaggttttgtgttgggttggttgtg
tttttgggtgggatgagtgtgaatgtttggtctgatagggttttagtggggttgaaaaaa
gagggcggagggtataagatccctaggggagggtggtttgagttggtgagctgccctaac
tactttggggaaatagtggagtgggtaggttgggcagtgatggcttggtcttgggcagga
ctggggtttttgctttacacgtgcgctaacttggttccgagggcacgtgcgaaccatagg
tggtatttggagaagtttggggaggattatccaaagtccagaaaagctgttattccattc
ttgtattga

DBGET integrated database retrieval system