KEGG   Fragaria vesca (woodland strawberry): 101295541Help
Entry
101295541         CDS       T02666                                 

Definition
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:fve01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:fve01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 393 aa AA seqDB search
MDLITSPTSNPKTHHYFKLHRSFLRPGSLVLGLRPLPQSSKVLNFAHCSSKQSEPNKCLS
STKLFTHFLSNSSRTVPSITTNAALAESTEPEPETEQGKYNRILLSDVIVKRPRHVFKGR
KWSTMDLATAGVVVGMHVLSLLAPFQFNWGALWVAVSLYVVTGLFGITLSYHRNLSHRSF
KLPKWLEYLFAYCGAQALQGSPIDWVCTHRYHHQFCDSEKDPHSPIEGFWFSHMSWLFDT
NSVTERCGGLDNVGDLQKQPFYQFLKATYIAHPVALGALLYAMGGFPFIVWGMGVRIIWV
YHITWLVNSACHVWGEQAWNTGDLSRNNWWVALLAFGEGWHNNHHAFEYSARHGLDWWQL
DMTWYVVRLLQAIGLATDVKVPSEVQKQRMALN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggatttgatcacatcaccaacctccaatcccaaaacccaccattatttcaaactccac
cgctcatttctccggccagggagcctagttcttggtctccggccacttcctcagagctcc
aaagtcctcaactttgctcactgcagttcaaaacaatcagaacccaataaatgcttatca
agcacaaagcttttcacccattttctctccaattctagtagaacagtaccttcaataacc
accaatgcagctttggcagaatctacagaaccagagccagaaacagagcaaggaaagtac
aacaggattttactatctgatgtgattgtgaagaggcctagacatgtgtttaaggggaga
aaatggagcacaatggacttggccacagctggtgttgtggtggggatgcatgttctgagt
cttttggctccttttcaattcaattggggagctttatgggtggcagtctcactttatgtt
gtgactggcctatttggtatcactctttcttatcataggaacctttcacatagaagtttc
aagcttcccaagtggcttgagtacttgtttgcttactgtggagctcaagcacttcagggg
agcccaattgattgggtgtgtacacatagataccaccaccagttttgtgattctgagaaa
gacccacatagcccaattgaaggattctggtttagtcacatgagttggctctttgatacc
aattctgtgactgaaaggtgtgggggcctagataatgttggggatttacagaagcagccc
ttctatcagttcctaaaggcaacttacatcgctcacccagtcgctcttggtgctctactg
tatgcaatgggagggttccctttcattgtttggggaatgggtgtgaggatcatttgggtg
tatcacattacttggctggtaaactcagcttgccatgtttggggagagcaagcatggaat
actggtgacttgtccaggaacaattggtgggtggcattactagcatttggagagggatgg
cataataatcaccatgcttttgagtactcagctagacatggtctggattggtggcagctt
gatatgacttggtatgttgtaagattgctccaagctattggattggcaactgacgtgaag
gtaccatcagaggtacagaaacaaaggatggctttgaactaa

DBGET integrated database retrieval system