KEGG   Fragaria vesca (woodland strawberry): 101295835Help
Entry
101295835         CDS       T02666                                 

Definition
protoporphyrinogen oxidase, mitochondrial-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fve00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 506 aa AA seqDB search
MASPSQPHNHRSVKKVAVVGAGVSGLAAAYKLKSHGFDVTVLEAEGRAGGKLRSVSYNGL
IWDEGANTMTEAETEVQTLLDSLGLRDKQQFPISQNKRYVARNGMPVLLPTNPIELIKSN
FLSTKSKFQILLEPYLWKKKKVSDDHTQESVAGFFQRHFGKEVVDYLIDPFVAGTSAGDP
ESLSMPHSFPELWNIEKRYGSVITGTIRSKVSSRKEKRGDTKGSVEKGKRQRGSFSFQGG
MQTLTDTLCKQLGKHELKLNSKVLSLSYSHDGSSTSENWSLSCVANDDKHSQSSSVDAII
MTAPLCSIKEMKITRRGTIFPLDFLPEVNYMPLSVLITSFKKENIKRPLEGFGVLVPSKE
QENGLKTLGTLFSSMMFPDRAPSDQYLYTTFVGGSRNKELAKASKDELKQIVTSDIRQLL
GAEGEPTFVNHYYWSKAFPLYGHNYDSVIEAIEKMEKNLPGLFYAGNHRGGLSVGKAIAS
GCKAADLVISYLESSSDGKILQQGSS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccttcccaaccacacaaccaccgctccgttaaaaaagtggccgtcgtcggc
gccggtgttagtggccttgctgctgcctacaagctgaagtcacatggtttcgatgttacg
gtactcgaagccgagggaagagccggagggaagctgaggagtgtgtcttataatggcctg
atttgggatgagggagcaaacacaatgaccgaggctgagaccgaggtgcagactttgctt
gacagtctggggcttcgagacaagcaacaatttccaatttcacagaacaaacggtatgtt
gcacggaacggaatgcctgtgctgctacctaccaatccaattgagctgatcaagagcaac
tttctttctacaaaatcaaagtttcagattcttctggagccatatttgtggaagaaaaaa
aaagtgtctgatgatcacacccaagaaagtgtggctgggttttttcagcgtcattttggg
aaagaggtcgttgattatctcattgatccctttgttgctggtacaagtgctggagatcca
gaatctctttcgatgccacattcctttccggagttatggaacatagaaaagaggtatggt
tcggtcataactgggacaattcggtcaaaagtatcttccaggaaagaaaaacgtggagat
acaaaaggttctgtagagaaaggaaagcgtcagcgcggttctttttcctttcaaggtggt
atgcagacactcactgatacattgtgcaaacagcttggcaaacatgagcttaaactgaat
tcaaaggtcttatcattatcttacagtcatgatgggagcagtacatcagaaaattggtcg
ctttcctgtgttgctaatgatgacaagcattcacaaagttcatctgttgatgctataatc
atgacggctccattatgtagtatcaaagaaatgaagatcacaagaagaggaaccatcttc
cctcttgattttcttccagaggtgaattatatgccactatcagttcttataaccagcttc
aagaaggaaaacattaaaaggcctcttgagggatttggagttcttgttccctccaaagag
caggaaaatggcttaaaaacactaggtacactattttcttccatgatgtttccagatcgt
gcacctagtgaccaatatctttacactacgtttgttgggggaagtcgaaacaaggaactg
gcaaaagcttcaaaggatgagttgaagcaaattgttacctctgatataaggcaacttttg
ggagcagaaggcgagccgacatttgtgaatcattactactggagcaaagcatttccattg
tatgggcataactacgattcagtcatagaagcaatcgagaagatggagaaaaacctacct
ggtttattctatgcaggtaaccataggggtggactgtctgttggcaaagcaatagcttct
gggtgcaaagcagctgatcttgtaatctcctatctggaatcttcttcagatggcaagata
cttcagcaaggatcgtcatag

DBGET integrated database retrieval system