KEGG   Fragaria vesca (woodland strawberry): 101296228Help
Entry
101296228         CDS       T02666                                 

Definition
probable pectinesterase 48-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:fve00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fve00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 370 aa AA seqDB search
MAGIEKRMSIHAALMMITTVLLAATVSMADDPVIPSDKSAVDKWFQDNVKPLADRKSSLD
PDLVKAEDGDPKIVKVMANGGDFKKISEAIDSIPASNTKRVIIYVGGGVYNEKITIPKNK
PFVTLMGDSKNMPNLTFNGDSAKYGTLYSATLSVESDYFVGVNLNIINSSPRPDGKKEGA
QALALKLSGNKAALYNCQMFGFQDTLCDDQGNHFIKDSYVEGTVDFIFGSGKSLYLNTHI
NVLGDSGMTVITANAREGDEDKGYSFVHCSITGTGSGTFLGRAWRAAPKVTFAYTEMGEV
VKPEGWTDNNHPEYDKSVSFGEYKNTGPGSSMSKRVSFTKELSDADAKPFISLGFIDGSK
WLLPPPTPKV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggccggaatagagaaacggatgagcatccatgcagctctgatgatgatcacgacggtt
ctccttgctgctactgtttcaatggcagatgatcccgtcataccttccgacaaatcagca
gtggacaagtggttccaggacaatgtgaagccattggcagaccggaagtcctcgcttgac
cctgaccttgtcaaggcggaggacggtgatcccaaaattgtgaaggtcatggcaaatggg
ggagacttcaagaaaatctcagaggccattgatagcattccagccagtaacactaaacgt
gtgattatatacgttggagggggtgtctacaatgagaaaattacaattccgaaaaacaag
ccatttgtcacattaatgggggattcaaaaaacatgccgaatcttacctttaacggtgat
tctgccaaatatgggacattgtatagtgctacactgtcggtggaatctgactacttcgtc
ggagtgaatttaaatatcataaattcctcgccgaggccggatgggaaaaaagagggagca
caagcacttgccttgaagttgtctgggaacaaggctgcattgtacaattgccaaatgttt
ggatttcaggacaccctttgtgatgatcaaggcaatcatttcatcaaggactcctacgtt
gaaggaactgtagatttcatcttcggaagtggaaaatctctctatttgaacacacacata
aatgtgttaggagacagcggaatgacggtgataacagcaaatgcaagagaaggtgatgaa
gacaagggatactcatttgtccactgcagcataaccggcaccggcagtggcacatttttg
ggcagggcttggagggctgctcccaaggtgacctttgcctacaccgaaatgggagaagtt
gtcaagccagaaggatggaccgacaataaccaccccgaatatgacaagtctgttagtttt
ggagagtacaagaacactggtccaggttcaagcatgagtaagagagtaagcttcacgaaa
gagctgagcgatgcagatgccaaacctttcatcagcctaggctttattgacggttccaaa
tggttgcttcctcctccaactccaaaggtctaa

DBGET integrated database retrieval system